DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and PKH3

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_010754.1 Gene:PKH3 / 852077 SGDID:S000002874 Length:898 Species:Saccharomyces cerevisiae


Alignment Length:336 Identity:104/336 - (30%)
Similarity:184/336 - (54%) Gaps:52/336 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   710 KRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAER---DI 771
            ||:..|   |:..:.:|.|::..|.......:.|.:||:|...|..::|..:|.:|..|:   ::
Yeast     5 KRSPHD---FIFKEELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIEKNTMNL 66

  Fly   772 LAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHK 836
            ||:..:..::||||:|.|::|||||:|:.|||:|:|||.|:|.|.:...|.:.|::..|::.:|.
Yeast    67 LAQKHHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGTFNDIWTRHFTAQLIDALEFIHS 131

  Fly   837 MGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSENGPK 901
            .|.||||:||:|:|:||||.:.:||||...    |.:...   :|:.::.:|       ..||.|
Yeast   132 HGIIHRDLKPENVLLDRDGRLMITDFGAAA----TIDPSL---SGDSAKFNS-------DSNGSK 182

  Fly   902 PTVLERRRMRDHQRVLAHSLVGTPNYIAPEVL--ERSGYTQLCDYWSVGVILYEMLVGQPPFLAN 964
                      |:|.  ..|.|||..|::||:|  .:.||..  |.|::|.::|:.:.|||||...
Yeast   183 ----------DNQN--CASFVGTAEYVSPELLLYNQCGYGS--DIWALGCMIYQFVQGQPPFRGE 233

  Fly   965 SPLETQQKVINWEKTLHIP--PQAELSREAT-------DLIRR-LCASADKRLGKSVDEVKSHDF 1019
            :.|:|.:|::    .|..|  |...::...:       :|::: |....::|:  |::::|.|.:
Yeast   234 NELKTFEKIV----ALDYPWGPNNRINNSTSPINPLVINLVQKILVIEVNERI--SLEQIKRHPY 292

  Fly  1020 FKGIDFADMRK 1030
            |..:|:.|..|
Yeast   293 FSKVDWNDKIK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 101/329 (31%)
S_TKc 719..1020 CDD:214567 97/315 (31%)
PKH3NP_010754.1 STKc_PDK1 9..293 CDD:270733 98/320 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.