DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and WAG1

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_175774.1 Gene:WAG1 / 841807 AraportID:AT1G53700 Length:476 Species:Arabidopsis thaliana


Alignment Length:406 Identity:125/406 - (30%)
Similarity:188/406 - (46%) Gaps:75/406 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   719 FVKLKPIGVGAFGEVTLVSKIDTSNHL-YAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVK 782
            |..::.:|.|..|.|.|....|..|.. :|:|.:.: |||...:::||:.|.:||:..|:.::..
plant    93 FKLVRHLGTGNLGRVFLCHLRDCPNPTGFALKVIDR-DVLTAKKISHVETEAEILSLLDHPFLPT 156

  Fly   783 LYYSFQDKDNLYFVMDYIPGGDLMSLLIK-----LGIFEEELARFYIAEVTCAVDSVHKMGFIHR 842
            ||...........::||.|.|||.|||.|     |.|   ...||:.|||..|::.:|.:|.::|
plant   157 LYARIDASHYTCLLIDYCPNGDLHSLLRKQPNNRLPI---SPVRFFAAEVLVALEYLHALGIVYR 218

  Fly   843 DIKPDNILIDRDGHIKLTDFGLC-----------TGFRWTHNS--KYYQENGNHSRQDSMEPWEE 894
            |:||:||||..||||.|:||.||           ..||.|.:|  |..:..|..|.:...|..|.
plant   219 DLKPENILIREDGHIMLSDFDLCFKADVVPTFRSRRFRRTSSSPRKTRRGGGCFSTEVEYEREEI 283

  Fly   895 YSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQP 959
            .:|...:|..           ..:.|.|||..|:|||::..:|:....|:|:.|:.|||||.|..
plant   284 VAEFAAEPVT-----------AFSKSCVGTHEYLAPELVAGNGHGSGVDWWAFGIFLYEMLYGTT 337

  Fly   960 PFLANSPLETQQKVINWEK---TLHIPPQAELSREATDLIRRLCA-SADKRLG--KSVDEVKSHD 1018
            ||...:..:|.:.:::.:.   ||    :.|...||.|||.:|.. ...||||  :...::|.|:
plant   338 PFKGGTKEQTLRNIVSNDDVAFTL----EEEGMVEAKDLIEKLLVKDPRKRLGCARGAQDIKRHE 398

  Fly  1019 FFKGIDFADMRKQKAPYIPEIK-----------HPTDTSNFDPVDPEK-----------LRSNDS 1061
            ||:||.:..:|..|.   |||:           |.|..     |.|.:           |||. |
plant   399 FFEGIKWPLIRNYKP---PEIRGLVKKTKAHAGHVTAA-----VTPRRNKWLWWALSHLLRSK-S 454

  Fly  1062 TMSSGDDVDQNDRTFH 1077
            ...|...:..|:..:|
plant   455 LSKSSSKIQSNNNYYH 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 125/406 (31%)
S_TKc 719..1020 CDD:214567 105/325 (32%)
WAG1NP_175774.1 STKc_phototropin_like 91..416 CDD:270726 112/344 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.