DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and WAKL2

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_173064.1 Gene:WAKL2 / 838182 AraportID:AT1G16130 Length:748 Species:Arabidopsis thaliana


Alignment Length:498 Identity:107/498 - (21%)
Similarity:189/498 - (37%) Gaps:153/498 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   637 EEERKEFRIRQYSPQAFKFFMEQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQ 701
            ::.||..|:|       |||.    .|.....:|:..||              :..:||.::.:.
plant   367 QKRRKLIRMR-------KFFR----RNGGMLLKQQLARK--------------EGNVEMSRIFSS 406

  Fly   702 KESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVK 766
            .|     |::|   ...|.|.:.:|.|  |:.|:...:.....:.|:|..:..|   .::|....
plant   407 HE-----LEKA---TDNFNKNRVLGQG--GQGTVYKGMLVDGRIVAVKRSKAVD---EDRVEEFI 458

  Fly   767 AERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEEL--------ARFY 823
            .|..:||:.::..:|||.....:.:....|.:::|.|||...|      .:|.        .|.:
plant   459 NEVVVLAQINHRNIVKLLGCCLETEVPVLVYEFVPNGDLCKRL------HDESDDYTMTWEVRLH 517

  Fly   824 IA-EVTCAVDSVHKMG---FIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHS 884
            || |:..|:..:|...   ..|||||..|||:|.....|::|||.                   |
plant   518 IAIEIAGALSYLHSAASFPIYHRDIKTTNILLDERNRAKVSDFGT-------------------S 563

  Fly   885 RQDSMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGV 949
            |..:::                       |..|...:.||..|:.||..:.|.:|:..|.:|.||
plant   564 RSVTID-----------------------QTHLTTQVAGTFGYVDPEYFQSSKFTEKSDVYSFGV 605

  Fly   950 ILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSRE---ATDLIRRLCASADKRLGKSV 1011
            :|.|:|.|:.|   :|.:.:::   |.....|.....:.:|.   ..|.|:..|         ::
plant   606 VLVELLTGEKP---SSRVRSEE---NRGLAAHFVEAVKENRVLDIVDDRIKDEC---------NM 655

  Fly  1012 DEVKSHDFFKGIDFADMRK-------QKAPYIPEIKHPTDTSNFDPVDPEKLRSN--DSTMSSGD 1067
            |:|.|        .|::.:       :|.|.:.|:.          ::.|.:||:  ||.:...|
plant   656 DQVMS--------VANLARRCLNRKGKKRPNMREVS----------IELEMIRSSHYDSGIHIED 702

  Fly  1068 DVDQNDRTFHGFFEFTFR-------RFFDDKQPPDMTDDQAPV 1103
            |.:::|:.....|..|:.       ..|::..|   |.|..|:
plant   703 DDEEDDQAMELNFNDTWEVGATAPASMFNNASP---TSDAEPL 742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 84/384 (22%)
S_TKc 719..1020 CDD:214567 72/315 (23%)
WAKL2NP_173064.1 GUB_WAK_bind 32..136 CDD:290658
WAK 168..274 CDD:254827
TyrKc 418..686 CDD:197581 75/353 (21%)
STKc_IRAK 422..687 CDD:270968 74/350 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.