DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and PDK1

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_568138.1 Gene:PDK1 / 830330 AraportID:AT5G04510 Length:491 Species:Arabidopsis thaliana


Alignment Length:409 Identity:125/409 - (30%)
Similarity:188/409 - (45%) Gaps:76/409 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   690 QTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKL-------------KPIGVGAFGEVTLVSKIDT 741
            :.:.:.:.:|....||...:.|:   ||...|.             |..|||::.:|....|.:|
plant     5 EKEFDSKLVLQGNSSNGANVSRS---KSFSFKAPQENFTSHDFEFGKIYGVGSYSKVVRAKKKET 66

  Fly   742 SNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLM 806
            .. :||:|.:.|..:.|.|:.|:||.||.:|.:.::..::|||::|||..:||..::...||:|.
plant    67 GT-VYALKIMDKKFITKENKTAYVKLERIVLDQLEHPGIIKLYFTFQDTSSLYMALESCEGGELF 130

  Fly   807 SLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWT 871
            ..:.:.|...|:.||||.|||..|::.:|.||.|||||||:|:|:..|||||:.|||        
plant   131 DQITRKGRLSEDEARFYTAEVVDALEYIHSMGLIHRDIKPENLLLTSDGHIKIADFG-------- 187

  Fly   872 HNSKYYQENGNHSRQDSMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERS 936
                            |::|.::     .:.|||......|.    |.:.|||..|:.||||..|
plant   188 ----------------SVKPMQD-----SQITVLPNAASDDK----ACTFVGTAAYVPPEVLNSS 227

  Fly   937 GYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRLCA 1001
            ..|...|.|::|..||:||.|..||...|.....|::|  .:.:..|  ...|..|.|||.||..
plant   228 PATFGNDLWALGCTLYQMLSGTSPFKDASEWLIFQRII--ARDIKFP--NHFSEAARDLIDRLLD 288

  Fly  1002 SADKRLGKSVDE----VKSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDST 1062
            :...|...:..|    :|.|.||.|:|:.::|.|..|.:..          ||.........|.|
plant   289 TEPSRRPGAGSEGYVALKRHPFFNGVDWKNLRSQTPPKLAP----------DPASQTASPERDDT 343

  Fly  1063 MSS-------GDDV-DQND 1073
            ..|       ||.: .||:
plant   344 HGSPWNLTHIGDSLATQNE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 120/382 (31%)
S_TKc 719..1020 CDD:214567 103/317 (32%)
PDK1NP_568138.1 STKc_PDK1 42..311 CDD:270733 102/306 (33%)
PH_3 388..490 CDD:405303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.