DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and rps6ka1

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001071243.1 Gene:rps6ka1 / 777728 ZFINID:ZDB-GENE-060929-516 Length:310 Species:Danio rerio


Alignment Length:349 Identity:83/349 - (23%)
Similarity:144/349 - (41%) Gaps:112/349 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   742 SNHLYAMKTLRKAD---------VLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVM 797
            :|..||:|.:.|..         :|:..|..::...:|:               :.:...:|.|.
Zfish    15 TNTEYAVKVIDKTSTDPTEEIEILLRYGQHPNIITLKDV---------------YDNGKQVYLVT 64

  Fly   798 DYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNIL-IDRDGH---IK 858
            :.:.||:|:..::|...|.|..|...:..:|..|:.:|..|.:|||:||.||| :|..|:   ::
Zfish    65 ELMRGGELLDRILKQKFFSEREASAVLHTITKTVEYLHSQGVVHRDLKPSNILYVDESGNPESLR 129

  Fly   859 LTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVG 923
            :.|||.....|                          ::||                     |:.
Zfish   130 ICDFGFAKQLR--------------------------ADNG---------------------LLM 147

  Fly   924 TP----NYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVI---------- 974
            ||    |::|||||:|.||.:.||.||:||:||.|:.|..|| ||.|.:|.::::          
Zfish   148 TPCYTANFVAPEVLKRQGYDEGCDIWSLGVLLYTMIAGFTPF-ANGPEDTPEEILSRIGSGRFTL 211

  Fly   975 ---NWE-----------KTLHIPPQAELSREATDLIRRLCASADKRLGKSVDEVKSHDFFKG--- 1022
               ||:           |.||:.|...|:  |..:::........:|..|..:.:.....||   
Zfish   212 TGGNWDAVSDAAKDLVSKMLHVDPHQRLT--ARQVLKHPWIVQRDKLPNSQLQHQDAKLVKGAMA 274

  Fly  1023 IDFADMRKQKAPYIPEIKHPTDTS 1046
            ..::.::..:.|  ||:| |.::|
Zfish   275 ATYSALKSSQPP--PELK-PIESS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 83/349 (24%)
S_TKc 719..1020 CDD:214567 75/318 (24%)
rps6ka1NP_001071243.1 PKc_like 1..281 CDD:304357 77/330 (23%)
S_TKc 2..250 CDD:214567 73/299 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.