DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and RPS6KA3

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_011543857.1 Gene:RPS6KA3 / 6197 HGNCID:10432 Length:746 Species:Homo sapiens


Alignment Length:420 Identity:142/420 - (33%)
Similarity:215/420 - (51%) Gaps:82/420 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   679 EKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSN 743
            |:|::    |...::.::::   ..:::::....|.|.|.|..||.:|.|:||:|.||.||..|:
Human    35 EEEIN----PQTEEVSIKEI---AITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSD 92

  Fly   744 --HLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLM 806
              .|||||.|:||.:..|::| ..|.|||||.|.::.::|||:|:||.:..||.::|::.||||.
Human    93 ARQLYAMKVLKKATLKVRDRV-RTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLF 156

  Fly   807 SLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWT 871
            :.|.|..:|.||..:||:||:..|:|.:|.:|.|:||:||:|||:|.:||||||||||.      
Human   157 TRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLS------ 215

  Fly   872 HNSKYYQENGNHSRQDSMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERS 936
                  :|:.:|.::                               |:|..||..|:||||:.|.
Human   216 ------KESIDHEKK-------------------------------AYSFCGTVEYMAPEVVNRR 243

  Fly   937 GYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRLC- 1000
            |:||..|:||.||:::|||.|..||......||...::..:..:   ||. ||.||..|:|.|. 
Human   244 GHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGM---PQF-LSPEAQSLLRMLFK 304

  Fly  1001 --------------ASADKRLGKSVDEVKSHDFFKGIDFADM--RKQKAPYIPEIKHPTDTSNFD 1049
                          |..|     .|:|:|.|.||..||:..:  |:...|:.|....|.||..||
Human   305 RNPANRLVNPFLIGAGPD-----GVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFYFD 364

  Fly  1050 PVDPEKLRSNDSTMSSGDDVDQNDRTFHGF 1079
            |....|...:...:....:..|   .|.||
Human   365 PEFTAKTPKDSPGIPPSANAHQ---LFRGF 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 135/379 (36%)
S_TKc 719..1020 CDD:214567 118/317 (37%)
RPS6KA3XP_011543857.1 S_TKc 68..333 CDD:214567 118/317 (37%)
STKc_RSK_N 72..394 CDD:270734 134/376 (36%)
STKc_RSK2_C 408..737 CDD:271078
Pkinase 428..685 CDD:278497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.