DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and cdc42bpab

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_021324156.1 Gene:cdc42bpab / 566003 ZFINID:ZDB-GENE-080219-17 Length:1800 Species:Danio rerio


Alignment Length:401 Identity:156/401 - (38%)
Similarity:231/401 - (57%) Gaps:79/401 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   708 RLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDIL 772
            ::|:.::.|..|..||.||.||||||.:| |:..::.::|||.|.|.::|||.:.|..:.|||:|
Zfish    66 KVKQMRLHKEDFEILKVIGRGAFGEVAVV-KVKNTDKVFAMKILNKWEMLKRAETACFREERDVL 129

  Fly   773 AEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFE----EELARFYIAEVTCAVDS 833
            ...|..|:..|:|:|||::|||.||||..||||::||.|   ||    |::|:||:||:..|:||
Zfish   130 VNGDCQWITTLHYAFQDENNLYLVMDYYVGGDLLTLLSK---FEDRLPEDMAKFYLAEMVLAIDS 191

  Fly   834 VHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSEN 898
            ||::.::||||||||||:|.:|||:|.|||.|.                                
Zfish   192 VHQLHYVHRDIKPDNILMDMNGHIRLADFGSCL-------------------------------- 224

  Fly   899 GPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLE-----RSGYTQLCDYWSVGVILYEMLVGQ 958
                      ::.:...|.:...||||:||:||:|:     :..|...||:||:||.:||||.|:
Zfish   225 ----------KLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGE 279

  Fly   959 PPFLANSPLETQQKVINW-------EKTLHIPPQ-AELSREATDLIRRLCASADKRLGKS-VDEV 1014
            .||.|.|.:||..|::|.       |:....|.| .::|.:|.||:|||..|.:.|||:: :::.
Zfish   280 TPFYAESLVETYGKIMNHKSSQPNDEERFQFPLQVTDVSEDAKDLVRRLICSREHRLGQNGIEDF 344

  Fly  1015 KSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDS------TMSSGDDVDQND 1073
            |.|.||.|||:.::|..:||||||:..|||||||| ||.:.|::.::      |..||..:.   
Zfish   345 KQHPFFTGIDWDNIRTCEAPYIPEVSSPTDTSNFD-VDDDCLKNCETLPPPSHTAFSGHHLP--- 405

  Fly  1074 RTFHGFFEFTF 1084
                 |..||:
Zfish   406 -----FVGFTY 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 151/384 (39%)
S_TKc 719..1020 CDD:214567 125/318 (39%)
cdc42bpabXP_021324156.1 STKc_MRCK_alpha 4..419 CDD:270773 156/401 (39%)
SbcC 438..>945 CDD:223496
KELK 535..613 CDD:318090
DMPK_coil 887..947 CDD:117396
C1_1 1057..1107 CDD:278556
PH_MRCK 1117..1251 CDD:269949
CNH 1277..1539 CDD:307087
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.