DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and Pkc98E

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001287577.1 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster


Alignment Length:390 Identity:129/390 - (33%)
Similarity:202/390 - (51%) Gaps:81/390 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   722 LKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNN-WVVKLYY 785
            :|.:|.|:||:|.|..|..| :.:||:|.|:|..:::.:.|.....|:.|||.|.|: ::..|:.
  Fly   411 IKVLGKGSFGKVMLAEKKGT-DEIYAIKVLKKDAIIQDDDVDCTMTEKRILALAANHPFLTALHS 474

  Fly   786 SFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNIL 850
            .||..|.|:|||:|:.|||||..:.|...||...|.||.||||.|:..:|..|.|:||:|.||||
  Fly   475 CFQTPDRLFFVMEYVNGGDLMFQIQKARRFEASRAAFYAAEVTLALQFLHTHGVIYRDLKLDNIL 539

  Fly   851 IDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSENGPKPTVLERRRMRDHQR 915
            :|::||.||.|||:|                           :|...||                
  Fly   540 LDQEGHCKLADFGMC---------------------------KEGIMNG---------------- 561

  Fly   916 VLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVIN----- 975
            :|..:..|||:|||||:|:...|....|:|::||::|||:.|||||.|::..|....:::     
  Fly   562 MLTTTFCGTPDYIAPEILKEQEYGASVDWWALGVLMYEMMAGQPPFEADNEDELFDSIMHDDVLY 626

  Fly   976 --WEKTLHIPPQAELSREATDLIRR-LCASADKRLGKSVD--EVKSHDFFKGIDFADMRKQ--KA 1033
              |           |||||..:::. |..:.::|||.:.|  |::.|.||..:|:.::.|:  |.
  Fly   627 PVW-----------LSREAVSILKGFLTKNPEQRLGCTGDENEIRKHPFFAKLDWKELEKRNIKP 680

  Fly  1034 PYIPEIKHPTDTSNFDPVDPEKLRSNDSTMSS-GDDVDQ--NDRTFHGFFEFTFRRFFDDKQPPD 1095
            |:.|::|:|.|.:|||    .:....|..::. |::|.:  |...|.||      .|.:.|..|:
  Fly   681 PFRPKMKNPRDANNFD----AEFTKEDPVLTPIGNEVVRCINQDEFAGF------SFVNPKFGPE 735

  Fly  1096  1095
              Fly   736  735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 124/371 (33%)
S_TKc 719..1020 CDD:214567 106/308 (34%)
Pkc98ENP_001287577.1 C2_PKC_epsilon 1..134 CDD:175981
C1_1 177..228 CDD:278556
C1_1 252..304 CDD:278556
STKc_nPKC_epsilon 412..729 CDD:270743 127/381 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.