DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and sti

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster


Alignment Length:395 Identity:140/395 - (35%)
Similarity:209/395 - (52%) Gaps:74/395 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   710 KRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAE 774
            ::.:::...|:....||.|.||.|.||.:..| |.:||||.::|:.|    ..:.||.||||::.
  Fly   104 RKLRVNADDFLIKTLIGQGYFGNVHLVVERQT-NDIYAMKKIKKSVV----TTSQVKEERDIMSI 163

  Fly   775 ADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGF 839
            .::.|::.|.|:|||.||||.||:|:|||||:||:.:.|.|:|:|||||:||:|.|:.::|:||:
  Fly   164 RNSEWLINLQYAFQDNDNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGY 228

  Fly   840 IHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSENGPKPTV 904
            :||||||:||||||.|||||.|||         |:.....:|:                      
  Fly   229 VHRDIKPENILIDRFGHIKLADFG---------NAAALDRDGH---------------------- 262

  Fly   905 LERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQL------------CDYWSVGVILYEMLVG 957
                       ||:.|.||||:|||||:|:.....:|            |||||:|:|.||::..
  Fly   263 -----------VLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVSRIVSCDYWSMGIIGYELICE 316

  Fly   958 QPPFLANSPLETQQKVINWEKTLHI------PPQAELSREATDLIRRLCASADKRLGKSVDEVKS 1016
            ..||..::..||..|:::..:..|:      |...::|....:||..|..:..|||  |.:.:|:
  Fly   317 TTPFHEDNVHETYSKILSHCEESHLKELISFPADLKVSVNYRNLIESLVTNPSKRL--SYERIKN 379

  Fly  1017 HDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSND-------STMSSGDDVDQNDR 1074
            |.||..|.:..:|.|..|.||.::...|||||:.....|.|...       :|....:|....|.
  Fly   380 HPFFSEIPWGSIRSQVPPIIPTVRSDDDTSNFEDGIRHKTRREQGVAKKSLTTNMKSNDFSGKDL 444

  Fly  1075 TFHGF 1079
            .|.|:
  Fly   445 PFIGY 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 139/385 (36%)
S_TKc 719..1020 CDD:214567 120/318 (38%)
stiNP_001261768.1 PKc_like 111..452 CDD:304357 140/388 (36%)
S_TKc 113..383 CDD:214567 120/318 (38%)
Smc 487..1222 CDD:224117
CNH 1503..1774 CDD:279162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.