DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and S6k

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:418 Identity:134/418 - (32%)
Similarity:220/418 - (52%) Gaps:76/418 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   678 LEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKI--D 740
            ||.|: .:.|...|:.:....|.::..|..::|....|   |...|.:|.|.:|:|..|.|.  .
  Fly    40 LEPEL-CINLHQDTEGQETIQLCEENVNPGKIKLGPKD---FELKKVLGKGGYGKVFQVRKTAGR 100

  Fly   741 TSNHLYAMKTLRKADVL-KRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGD 804
            .:|..:|||.|:||.:: .:...||.:|||:||....:.::|:|.|:||....||.:::|:.||:
  Fly   101 DANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFIVELVYAFQTDGKLYLILEYLSGGE 165

  Fly   805 LMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFR 869
            |...|.:.|||.|:...||::|:..|:..:||:|.|:||:||:|||:|..||:||||||||    
  Fly   166 LFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLC---- 226

  Fly   870 WTHNSKYYQENGNHSRQDSMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLE 934
                                   :|:.:.|                ::.|:..||..|:|||:|.
  Fly   227 -----------------------KEHIQEG----------------IVTHTFCGTIEYMAPEILT 252

  Fly   935 RSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRL 999
            |||:.:..|:||:|.::::||.|.|||.|.:..:|.:.::  :..|::|  |.|:.||.||:|||
  Fly   253 RSGHGKAVDWWSLGALMFDMLTGVPPFTAENRKKTIETIL--KAKLNLP--AYLTPEARDLVRRL 313

  Fly  1000 CASAD-KRLGKSVDE---VKSHDFFKGIDFADM--RKQKAPYIPEIKHPTDTSNFD-------PV 1051
            ....: :|||...::   |:.|.|||.:::.|:  |:.:.|..|.::...|.|.||       ||
  Fly   314 MKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPV 378

  Fly  1052 DPEKLRSNDSTMSSGDDVDQNDRTFHGF 1079
            |    ..:|:|:|...::     .|.||
  Fly   379 D----SPDDTTLSESANL-----IFQGF 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 123/376 (33%)
S_TKc 719..1020 CDD:214567 105/307 (34%)
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 124/379 (33%)
STKc_p70S6K 81..402 CDD:270736 124/373 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.