DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and Pdk1

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001261183.1 Gene:Pdk1 / 38017 FlyBaseID:FBgn0020386 Length:836 Species:Drosophila melanogaster


Alignment Length:519 Identity:133/519 - (25%)
Similarity:234/519 - (45%) Gaps:95/519 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   566 NNNNIQISNSNLAT---TPPIPPAKYNNNSSNTGANSSGGSNGSTGTTASSSTSCKKIKHASPIP 627
            ||||.:..:|...|   |.|:..|..:|:||                 .:::..|:.:.:.|   
  Fly   136 NNNNSRYGSSKYLTNGHTSPLAAAVASNSSS-----------------VATTPHCRMLHNCS--- 180

  Fly   628 ERKKISKEKEEERKEFRIRQYSPQAFKFFMEQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQ 692
                             ::||...   ...:..|.::::...|:.|:..|.:::      |.|.|
  Fly   181 -----------------LQQYQND---IRQQTEILDMLRQQHQQGYQSQQQQQQ------PQQQQ 219

  Fly   693 IEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVL 757
            .:.::....::...::....:...:.|:..:.||.|::..|.|...|. |...||:|...|..:|
  Fly   220 EQQQQQEQSQQQQQLQNPAPRRSPNDFIFGRYIGEGSYSIVYLAVDIH-SRREYAIKVCEKRLIL 283

  Fly   758 KRNQVAHVKAERDILAEADN-NWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELAR 821
            :..:..::|.||:::.:..| ...|.|..:|||:.:|||||.|...||::..:.::|.|:....|
  Fly   284 RERKQDYIKREREVMHQMTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTR 348

  Fly   822 FYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFG-----------LCTGFRWTHNSK 875
            .|.||:..|.:.:|:...:|||:||:|||:|.|.|..:.|||           |.|    .|.|:
  Fly   349 HYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALAT----EHCSE 409

  Fly   876 YYQENGNHSRQDS--MEPWEE--YS------ENGPKPTVLE-----RRRMRDHQRVLAHSLVGTP 925
            ..:.|.:...:||  :|..:|  |.      ::|......|     |.|.|.:.|....|.|||.
  Fly   410 QRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTA 474

  Fly   926 NYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSR 990
            .|::||||:....|...|.|::|.|:|:|:.|.|||..::.....:::::.....   ||. ..:
  Fly   475 QYVSPEVLQNGPITPAADLWALGCIVYQMIAGLPPFRGSNDYVIFKEILDCAVDF---PQG-FDK 535

  Fly   991 EATDLIRRLC-ASADKRLGKS-----VDEVKSHDFFKGIDFADMRKQKA----PYIPEIKHPTD 1044
            :|.||:|:|. .....|||..     .:.:::|.||.|||:..:|:|..    ||:|.:....|
  Fly   536 DAEDLVRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIYPYLPGVSQDED 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 110/365 (30%)
S_TKc 719..1020 CDD:214567 99/333 (30%)
Pdk1NP_001261183.1 STKc_PDK1 244..571 CDD:270733 99/335 (30%)
S_TKc 246..571 CDD:214567 99/333 (30%)
PH_PDK1 658..764 CDD:241293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.