DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and gek

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_523837.2 Gene:gek / 37858 FlyBaseID:FBgn0023081 Length:1637 Species:Drosophila melanogaster


Alignment Length:404 Identity:151/404 - (37%)
Similarity:222/404 - (54%) Gaps:73/404 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 SNYIRL--------KRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRN 760
            |::::|        ::.::.:..|..||.||.||||||.:|..|.|.. :||||.|.|.::|||.
  Fly    77 SDFLKLSKPFVHIVRKLRLSRDDFDILKIIGRGAFGEVCVVQMISTEK-VYAMKILNKWEMLKRA 140

  Fly   761 QVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFE----EELAR 821
            :.|..:.|||:|...|..|:..|:|:|||..|||.||||..||||::||.|   ||    |::|:
  Fly   141 ETACFREERDVLVFGDRQWITNLHYAFQDNINLYLVMDYYCGGDLLTLLSK---FEDKLPEDMAK 202

  Fly   822 FYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQ 886
            |||.|:..|::|:|::.::||||||||:|:|:.||::|.|||.|.                    
  Fly   203 FYITEMILAINSIHQIRYVHRDIKPDNVLLDKRGHVRLADFGSCL-------------------- 247

  Fly   887 DSMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLE-----RSGYTQLCDYWS 946
                                  |:.....|.::..||||:||:||:|.     :..|...||:||
  Fly   248 ----------------------RLDKDGTVQSNVAVGTPDYISPEILRAMEDGKGRYGTECDWWS 290

  Fly   947 VGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAEL----SREATDLIRRLCASADKRL 1007
            :||.:||||.|:.||.|.|.:||..|::|.:...::|.|..|    |..:.||:.:|....:.||
  Fly   291 LGVCMYEMLYGETPFYAESLVETYGKIMNHQNCFNLPSQETLNYKVSETSQDLLCKLICIPENRL 355

  Fly  1008 GKS-VDEVKSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDSTMSSGDDVDQ 1071
            |:: :.:...|.:|.|||:.::|:..|||:||:..|||||||| ||...:|..||...|.:....
  Fly   356 GQNGIQDFMDHPWFVGIDWKNIRQGPAPYVPEVSSPTDTSNFD-VDDNDVRLTDSIPPSANPAFS 419

  Fly  1072 NDRTFH-GFFEFTF 1084
            .   || .|..|||
  Fly   420 G---FHLPFIGFTF 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 145/375 (39%)
S_TKc 719..1020 CDD:214567 119/314 (38%)
gekNP_523837.2 STKc_DMPK_like 98..430 CDD:270748 147/381 (39%)
S_TKc 100..369 CDD:214567 119/314 (38%)
KELK 478..556 CDD:292424
CEP63 492..749 CDD:293650
CEP63 652..880 CDD:293650
C1_1 990..1040 CDD:278556
PH_MRCK 1049..1182 CDD:269949
CNH 1211..1486 CDD:279162
CRIB 1544..1580 CDD:238077
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D21674at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.