DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and inaC

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster


Alignment Length:588 Identity:156/588 - (26%)
Similarity:260/588 - (44%) Gaps:131/588 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   565 CNNNNIQISNSNLATTPPIPPA---------------KYNN------NSSNTGANSSGGSN---- 604
            |.|.|:.:.::...|.||:..|               |.||      .::|.....:.|.:    
  Fly   167 CENCNLNVHHACQETVPPMCGADISEVRGKLLLYVELKGNNLKVDIKEAANLIPMDTNGFSDPYI 231

  Fly   605 ------GSTGTTASSSTSCKKIKHASPI-PERKKISKEKEEERKEFRI---------RQYSPQAF 653
                  ..:|.|...:.:.:  |:.:|: .|......:.::..|...|         |.....:|
  Fly   232 AVQMHPDRSGRTKKKTKTIQ--KNLNPVFNETFTFELQPQDRDKRLLIEVWDWDRTSRNDFMGSF 294

  Fly   654 KFFMEQHIENVIKSYRQRTYR-KNQLEKEMHKV----------GLPDQTQIEMR----KMLNQKE 703
            .|.:|:..:..:..:    |: .:|:|.|.:.:          .|.|:.:.:.|    :.::.|:
  Fly   295 SFSLEELQKEPVDGW----YKFLSQVEGEHYNIPCVDAFNDIARLRDEVRHDRRPNEKRRMDNKD 355

  Fly   704 SNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAE 768
            ..:...||..:..:.|..:|.||.|:||:|.|..:..| :.|||:|.|||..:::.:.:.....|
  Fly   356 MPHNMSKRDMIRAADFNFVKVIGKGSFGKVLLAERRGT-DELYAVKVLRKDVIIQTDDMELPMNE 419

  Fly   769 RDILAEADN-NWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVD 832
            :.|||.:.. .::|.::..||..|.|:|||:|..|||||..:.:.|.|:|.:|.||..||..|:.
  Fly   420 KKILALSGRPPFLVSMHSCFQTMDRLFFVMEYCKGGDLMYHMQQYGRFKESVAIFYAVEVAIALF 484

  Fly   833 SVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSE 897
            .:|:...|:||:|.||||:|.:||:||.||||                               |:
  Fly   485 FLHERDIIYRDLKLDNILLDGEGHVKLVDFGL-------------------------------SK 518

  Fly   898 NGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFL 962
            .|    |.||:..|        :..|||||:|||::....|:...|:||.||:|:|.:.||.||.
  Fly   519 EG----VTERQTTR--------TFCGTPNYMAPEIVSYDPYSIAADWWSFGVLLFEFMAGQAPFE 571

  Fly   963 ANSPLETQQKVINWEKTLHIPPQAELSREATDLIRR-LCASADKRLGK---SVDEVKSHDFFKGI 1023
            .:......:.:  .:|....|  ...|.||.|:|.. |....:.|||.   :..|:.:|.||:.:
  Fly   572 GDDETTVFRNI--KDKKAVFP--KHFSVEAMDIITSFLTKKPNNRLGAGRYARQEITTHPFFRNV 632

  Fly  1024 DF--ADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDSTMSSGD-----DVDQNDRTFHGFFE 1081
            |:  |:..:.:.|..|.|||..|.||||    :......:.::..|     ::||||     |..
  Fly   633 DWDKAEACEMEPPIKPMIKHRKDISNFD----DAFTKEKTDLTPTDKLFMMNLDQND-----FIG 688

  Fly  1082 FTF 1084
            |:|
  Fly   689 FSF 691

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 120/372 (32%)
S_TKc 719..1020 CDD:214567 101/305 (33%)
inaCNP_476863.1 C1_1 72..124 CDD:278556
C1_1 137..189 CDD:278556 6/21 (29%)
C2_PKC_alpha_gamma 194..324 CDD:175992 20/135 (15%)
S_TKc 371..629 CDD:214567 101/305 (33%)
STKc_PKC 375..692 CDD:270722 122/374 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.