DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and Dmpk

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_038967160.1 Gene:Dmpk / 308405 RGDID:1309825 Length:646 Species:Rattus norvegicus


Alignment Length:370 Identity:146/370 - (39%)
Similarity:213/370 - (57%) Gaps:60/370 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   708 RLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDIL 772
            |||..::.:..|..||.||.|||.||.:| |:..:..:||||.:.|.|:|||.:|:..:.|||:|
  Rat    60 RLKEVRLQRDDFEILKVIGRGAFSEVAVV-KMKQTGQVYAMKIMNKWDMLKRGEVSCFREERDVL 123

  Fly   773 AEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLG-IFEEELARFYIAEVTCAVDSVHK 836
            .:.|..|:.:|:::|||::.||.||:|..||||::||.|.| ....|:||||:||:..|:||||:
  Rat   124 VKGDRRWITQLHFAFQDENYLYLVMEYYVGGDLLTLLSKFGERIPAEMARFYLAEIVMAIDSVHR 188

  Fly   837 MGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSENGPK 901
            :|::||||||||||:||.|||:|.|||.|...:                              |.
  Rat   189 LGYVHRDIKPDNILLDRCGHIRLADFGSCLKLQ------------------------------PD 223

  Fly   902 PTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSG-------YTQLCDYWSVGVILYEMLVGQP 959
            .||          |.|.  .||||:|::||:|:..|       |...||:|::||..|||..||.
  Rat   224 GTV----------RSLV--AVGTPDYLSPEILQAVGGGPGAGSYGPECDWWALGVFAYEMFYGQT 276

  Fly   960 PFLANSPLETQQKVINWEKTLHIPPQAELS--REATDLIRRLCASADKRLGK-SVDEVKSHDFFK 1021
            ||.|:|..||..|::::.:.|.: |:|::.  .||.||||.|...|:.|||: ...:.:.|.||.
  Rat   277 PFYADSTAETYAKIVHYREHLSL-PRADMGVPEEAQDLIRGLLCPAEIRLGRGGAGDFQKHPFFF 340

  Fly  1022 GIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDSTMSSG 1066
            |:|:..:|....|:.|:.:..|||.|||.|: ::|    :.|.||
  Rat   341 GLDWEGLRDSVPPFTPDFEGATDTCNFDVVE-DRL----TAMVSG 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 143/361 (40%)
S_TKc 719..1020 CDD:214567 125/311 (40%)
DmpkXP_038967160.1 PKc_like 69..406 CDD:419665 143/361 (40%)
DMPK_coil 472..532 CDD:117396
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.