DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and Cdc42bpg

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_038964401.1 Gene:Cdc42bpg / 293693 RGDID:1307260 Length:1558 Species:Rattus norvegicus


Alignment Length:400 Identity:153/400 - (38%)
Similarity:224/400 - (56%) Gaps:68/400 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   708 RLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDIL 772
            ::|..::.:..|..||.||.||||||.:|.:.| |..::|||.|.|.::|||.:.|..:.|||:|
  Rat    60 KVKELRLQRDDFEILKVIGRGAFGEVAVVRQRD-SGQIFAMKMLHKWEMLKRAETACFREERDVL 123

  Fly   773 AEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEE----ELARFYIAEVTCAVDS 833
            .:.|:.||..|:|:|||::.||.||||..||||::||.:   ||:    |||:||:||:..|:.|
  Rat   124 VKGDSRWVTALHYAFQDEEYLYLVMDYYAGGDLLTLLSR---FEDRLPPELAQFYLAEMVLAIHS 185

  Fly   834 VHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSEN 898
            :|::|::|||:||||||:|.:|||:|.|||.|.                                
  Rat   186 LHQLGYVHRDVKPDNILLDMNGHIRLADFGSCL-------------------------------- 218

  Fly   899 GPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLE-----RSGYTQLCDYWSVGVILYEMLVGQ 958
                      |:.::..|.:...||||:||:||:|:     :..|...||:||:||..||:|.|:
  Rat   219 ----------RLNNNGMVDSSVAVGTPDYISPEILQAMEEGKGHYGPQCDWWSLGVCAYELLFGE 273

  Fly   959 PPFLANSPLETQQKVINWEKTLHIPPQA-ELSREATDLIRRLCASADKRLGK-SVDEVKSHDFFK 1021
            .||.|.|.:||..|::|.|..|..|... ::...|..|||:|....::|||: .:|:.:||.||:
  Rat   274 TPFYAESLVETYGKIMNHEDHLQFPSDVDDVPASAQALIRQLLCRQEERLGRGGLDDFRSHPFFE 338

  Fly  1022 GIDFADMRKQKAPYIPEIKHPTDTSNFDPVD-----PEKLRSNDSTMSSGDDVDQNDRTFHGFFE 1081
            |:|:..:....||||||::.|.||||||..|     ||.|..:.....||..:     .|.| |.
  Rat   339 GVDWERLATSTAPYIPELRGPVDTSNFDVDDDTLNRPETLPPSSHGAFSGHHL-----PFVG-FT 397

  Fly  1082 FTFRRFFDDK 1091
            :|.....|||
  Rat   398 YTSGSLTDDK 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 146/376 (39%)
S_TKc 719..1020 CDD:214567 122/311 (39%)
Cdc42bpgXP_038964401.1 STKc_DMPK_like 69..399 CDD:270748 148/381 (39%)
SMC_prok_B <450..809 CDD:274008
C1_MRCKgamma 885..936 CDD:410416
PH_MRCK 944..1076 CDD:269949
CNH 1103..1366 CDD:395630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.