DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and Rock2

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_008762796.1 Gene:Rock2 / 25537 RGDID:3590 Length:1473 Species:Rattus norvegicus


Alignment Length:411 Identity:149/411 - (36%)
Similarity:220/411 - (53%) Gaps:71/411 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   699 LNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVA 763
            ||:.|....:::..:|....:..:|.||.||||||.|| :...|..:||||.|.|.:::||:..|
  Rat    72 LNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLV-RHKASQKVYAMKLLSKFEMIKRSDSA 135

  Fly   764 HVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVT 828
            ....||||:|.|::.|||:|:.:|||...||.||:|:|||||::|:....: .|:.|:||.|||.
  Rat   136 FFWEERDIMAFANSPWVVQLFCAFQDDRYLYMVMEYMPGGDLVNLMSNYDV-PEKWAKFYTAEVV 199

  Fly   829 CAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWE 893
            .|:|::|.||.||||:||||:|:|:.||:||.|||.|                            
  Rat   200 LALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTC---------------------------- 236

  Fly   894 EYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSG----YTQLCDYWSVGVILYEM 954
                          .:|.:...|...:.||||:||:||||:..|    |.:.||:|||||.|:||
  Rat   237 --------------MKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEM 287

  Fly   955 LVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRLCASADKRLGKS-VDEVKSHD 1018
            |||..||.|:|.:.|..|:::.:.:|..|...|:|:.|.:||.......:.|||:: |:|:|.|.
  Rat   288 LVGDTPFYADSLVGTYSKIMDHKNSLCFPEDTEISKHAKNLICAFLTDREVRLGRNGVEEIKQHP 352

  Fly  1019 FFKG--IDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDSTMSSGDDVDQ---------N 1072
            |||.  .::.::|:..||.:||:....|:||||.::.:|           .||:.         |
  Rat   353 FFKNDQWNWDNIRETAAPVVPELSSDIDSSNFDDIEDDK-----------GDVETFPIPKAFVGN 406

  Fly  1073 DRTFHGFFEFTFRRFFDDKQP 1093
            ...|.||..|.......|..|
  Rat   407 QLPFIGFTYFRENLLLSDSPP 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 140/376 (37%)
S_TKc 719..1020 CDD:214567 122/305 (40%)
Rock2XP_008762796.1 STKc_ROCK2 39..417 CDD:270771 146/399 (37%)
S_TKc 92..354 CDD:214567 122/305 (40%)
Smc <437..1101 CDD:224117
HR1_ROCK2 505..571 CDD:212028
Rho_Binding 979..1046 CDD:286056
PH_ROCK 1208..1314 CDD:269948
C1 1318..1364 CDD:237996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.