DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and gad8

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_588010.1 Gene:gad8 / 2539206 PomBaseID:SPCC24B10.07 Length:569 Species:Schizosaccharomyces pombe


Alignment Length:622 Identity:175/622 - (28%)
Similarity:279/622 - (44%) Gaps:167/622 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 AQRERDQRERDQRERERDQQKLANGNPGRQMLPPPPYQSNNNNNSEIKPPSCN---NNNIQISNS 575
            :::..|::.|...|.:|..|... ..||  :|.....::.|     :|.||.:   |..:.|.||
pombe    41 SRKSSDEKSRKSSEDKRSPQSTV-VQPG--LLQVTIIEARN-----LKLPSGHVPANYGVSIDNS 97

  Fly   576 NLATTPPIPPAKYNNNSSNTGANSSGGSNGSTGTTASSSTSCKKIKHASPIP------ERKKI-- 632
            .||  ||:                   |||| |...|.|       ||..:|      ::.:|  
pombe    98 LLA--PPL-------------------SNGS-GHARSRS-------HAWWLPYIVVEFDKNEILV 133

  Fly   633 ------SKEKE--EERKEFRIRQYSPQAFKFFMEQHIENVIKSYRQR----------------TY 673
                  |.|..  :.:..|.:.:||..:...::..      .|.|.|                ::
pombe   134 DALNTASLENPCWDYQATFDVSRYSKLSLNIYLRS------SSSRSRNGMGNDAFLGGIKLSPSF 192

  Fly   674 RKNQLEKE---MHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTL 735
            ..|:|..|   :|  |...:.:::|....||.         ..:....|..||.:|.|:||:|..
pombe   193 IVNKLTDEWVPLH--GGSGELRVQMLYKPNQS---------TPLTIDAFELLKVVGKGSFGKVMQ 246

  Fly   736 VSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYI 800
            |.|.||| .:||:||::||.::.|::|.|..|||.:||:.:|.::|.|.:|||....||.|:.::
pombe   247 VRKRDTS-RIYALKTMKKAHIVSRSEVDHTLAERTVLAQVNNPFIVPLKFSFQSPGKLYLVLAFV 310

  Fly   801 PGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLC 865
            .||:|...|.:.|.|:...|:|||||:..|::.:|:...|:||:||:|||:|..|||.|.|||||
pombe   311 NGGELFHHLQREGCFDTYRAKFYIAELLVALECLHEFNVIYRDLKPENILLDYTGHIALCDFGLC 375

  Fly   866 TGFRWTHNSKYYQENGNHSRQDSMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAP 930
                          ..|.::.|.                             .::..|||.|:||
pombe   376 --------------KLNMAKTDR-----------------------------TNTFCGTPEYLAP 397

  Fly   931 EVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATDL 995
            |:|...|||::.|:|::||:||||:.|.|||...:..|..:|::  :..|..|.  .:..:|.||
pombe   398 ELLLGHGYTKVVDWWTLGVLLYEMITGLPPFYDENINEMYRKIL--QDPLRFPD--NIDEKAKDL 458

  Fly   996 IRRLCASA-DKRLGK-SVDEVKSHDFFKGIDFADM--RKQKAPYIPEIKHPTDTSNFD------- 1049
            :..|...| :||||. ...|:|:|.||..||:..:  :|.:.|:.|.::...||||||       
pombe   459 LSGLLTRAPEKRLGSGGAQEIKNHPFFDDIDWKKLCAKKIQPPFKPSVESAIDTSNFDSEFTSEI 523

  Fly  1050 PVDPEKLRSN----------------DSTMSSGDDVD 1070
            |:|.....|:                .:|:.:.||::
pombe   524 PMDSVVADSHLSETVQQRFANWSYQRPTTIDTSDDIN 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 128/381 (34%)
S_TKc 719..1020 CDD:214567 109/302 (36%)
gad8NP_588010.1 YPK1_N_like 66..225 CDD:212165 42/211 (20%)
PTZ00263 214..545 CDD:140289 128/387 (33%)
STKc_YPK1_like 235..547 CDD:270737 122/359 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.