DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and Stk38l

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_006507092.1 Gene:Stk38l / 232533 MGIID:1922250 Length:477 Species:Mus musculus


Alignment Length:459 Identity:196/459 - (42%)
Similarity:286/459 - (62%) Gaps:55/459 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   654 KFFMEQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSM 718
            |..:|....|:|..:.:|..|:.:||..|.:.||.|:.:...|....:||:.::||||.::....
Mouse    31 KLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDD 95

  Fly   719 FVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKL 783
            |..||.||.||||||.||.|.|| .|:||||.|||||:|::.||||::||||||.|||..||||:
Mouse    96 FESLKVIGRGAFGEVRLVQKKDT-GHIYAMKILRKADMLEKEQVAHIRAERDILVEADGAWVVKM 159

  Fly   784 YYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDN 848
            :||||||.|||.:|:::||||:|:||:|.....||..:|||:|...|:|::|::||||||:||||
Mouse   160 FYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDVKPDN 224

  Fly   849 ILIDRDGHIKLTDFGLCTGFRWTHNSKYYQ------------ENGNHSRQDSMEPWEEYSENGPK 901
            :|:|..||:||:|||||||.:..|.:::|:            :|.|..|:  .|.|::       
Mouse   225 LLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRK--AETWKK------- 280

  Fly   902 PTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSP 966
                       ::|.||:|.||||:||||||..::||.:|||:||:|||:||||:|.|||.:.:|
Mouse   281 -----------NRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGFPPFCSETP 334

  Fly   967 LETQQKVINWEKTLHIPPQAELSREATDLIRRLCASADKRLGK-SVDEVKSHDFFKGIDFADMRK 1030
            .||.:||::|::||..||:..:|.:|.|||.|.|..::.|:|. .|:|:|.|.||:|:|:..:|:
Mouse   335 QETYRKVMSWKETLAFPPEVPVSEKAKDLILRFCTDSENRIGNGGVEEIKGHPFFEGVDWGHIRE 399

  Fly  1031 QKAPYIPEIKHPTDTSNFDPVDPEKL------------RSNDSTMSSGDDVDQNDRTFHGFFEFT 1083
            :.|....||:...||||||......:            .:.:....|.|.|         |..:|
Mouse   400 RPAAIPIEIRSIDDTSNFDDFPESDILQPVAFFLFLVPNTTEPDYKSKDWV---------FLNYT 455

  Fly  1084 FRRF 1087
            ::||
Mouse   456 YKRF 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 173/385 (45%)
S_TKc 719..1020 CDD:214567 156/313 (50%)
Stk38lXP_006507092.1 STKc_NDR2 93..465 CDD:270776 177/397 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D216969at33208
OrthoFinder 1 1.000 - - FOG0000273
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.