DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and T24D5.4

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_510105.1 Gene:T24D5.4 / 188852 WormBaseID:WBGene00011992 Length:89 Species:Caenorhabditis elegans


Alignment Length:84 Identity:35/84 - (41%)
Similarity:52/84 - (61%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   913 HQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWE 977
            |:|:.||.||||.||:||||:.:.|..|.||:|..||:|.:|:.|:.||..::|..||.::.||.
 Worm     6 HRRITAHFLVGTGNYVAPEVIAKPGPNQSCDWWLTGVVLCKMVFGRVPFHDDTPGGTQYRIKNWR 70

  Fly   978 KTLHIPPQAELSREATDLI 996
            ..|.......||::...:|
 Worm    71 SFLDFVYCGNLSKDCLTMI 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 35/84 (42%)
S_TKc 719..1020 CDD:214567 35/84 (42%)
T24D5.4NP_510105.1 PKc_like <10..>89 CDD:389743 32/78 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163332
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0608
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000273
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.