DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and DMPK

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001275693.1 Gene:DMPK / 1760 HGNCID:2933 Length:655 Species:Homo sapiens


Alignment Length:363 Identity:138/363 - (38%)
Similarity:207/363 - (57%) Gaps:53/363 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   700 NQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAH 764
            ::.|...:|||..::.:..|..||.||.|||.||.:| |:..:..:||||.:.|.|:|||.:|:.
Human    78 SRAEPIVVRLKEVRLQRDDFEILKVIGRGAFSEVAVV-KMKQTGQVYAMKIMNKWDMLKRGEVSC 141

  Fly   765 VKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLG-IFEEELARFYIAEVT 828
            .:.|||:|...|..|:.:|:::|||::.||.||:|..||||::||.|.| ....|:||||:||:.
Human   142 FREERDVLVNGDRRWITQLHFAFQDENYLYLVMEYYVGGDLLTLLSKFGERIPAEMARFYLAEIV 206

  Fly   829 CAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWE 893
            .|:||||::|::||||||||||:||.|||:|.|||.|.                           
Human   207 MAIDSVHRLGYVHRDIKPDNILLDRCGHIRLADFGSCL--------------------------- 244

  Fly   894 EYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSG-------YTQLCDYWSVGVIL 951
                           ::|....|.:...||||:|::||:|:..|       |...||:|::||..
Human   245 ---------------KLRADGTVRSLVAVGTPDYLSPEILQAVGGGPGTGSYGPECDWWALGVFA 294

  Fly   952 YEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAE-LSREATDLIRRLCASADKRLGK-SVDEV 1014
            |||..||.||.|:|..||..|::::::.|.:|...| :..||.|.|:||....:.|||: ...:.
Human   295 YEMFYGQTPFYADSTAETYGKIVHYKEHLSLPLVDEGVPEEARDFIQRLLCPPETRLGRGGAGDF 359

  Fly  1015 KSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVD 1052
            ::|.||.|:|:..:|....|:.|:.:..|||.|||.|:
Human   360 RTHPFFFGLDWDGLRDSVPPFTPDFEGATDTCNFDLVE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 134/346 (39%)
S_TKc 719..1020 CDD:214567 120/310 (39%)
DMPKNP_001275693.1 STKc_DMPK_like 95..432 CDD:270748 134/346 (39%)
S_TKc 97..365 CDD:214567 120/310 (39%)
DMPK_coil 496..556 CDD:117396
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.