DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and let-502

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_491440.1 Gene:let-502 / 172088 WormBaseID:WBGene00002694 Length:1173 Species:Caenorhabditis elegans


Alignment Length:396 Identity:150/396 - (37%)
Similarity:220/396 - (55%) Gaps:67/396 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 SNYIR----LKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAH 764
            |.|.|    |...:|..:.|.:||.||.||||||.||....| |.:||||.|.|.|::||...|.
 Worm    49 SRYERVVESLAALRMKAADFRQLKVIGRGAFGEVHLVRHTRT-NTVYAMKMLNKDDMIKRADSAF 112

  Fly   765 VKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTC 829
            ...||||:|.|::.|:|:|.|:|||..:||.||:|:|||||::|:....: .|:..|||.||:..
 Worm   113 FWEERDIMAHANSEWIVRLQYAFQDPRHLYMVMEYMPGGDLVNLMTSYEV-SEKWTRFYTAEIVE 176

  Fly   830 AVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEE 894
            |:.::|.||:||||:||||:||...|||||.|||.|.                            
 Worm   177 ALAALHSMGYIHRDVKPDNMLISISGHIKLADFGTCV---------------------------- 213

  Fly   895 YSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSG----YTQLCDYWSVGVILYEML 955
                          :|..:..|...:.||||:||:||||...|    :.:..|:|||||.:||||
 Worm   214 --------------KMNANGVVRCSTAVGTPDYISPEVLRNQGQDAEFGKEVDWWSVGVFIYEML 264

  Fly   956 VGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRLCASADKRLGK-SVDEVKSHDF 1019
            ||:.||.|.:.:.|...::|.:.:|..|.:..:|.:|.|:|::..::|..|||: |||::::|.|
 Worm   265 VGETPFYAEALVSTYTNIMNHKTSLKFPDEPLISTQAKDIIKKFLSAAPDRLGRNSVDDIRNHKF 329

  Fly  1020 FKGID--FADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDSTMSSGDDVDQNDRTFHG---- 1078
            |...:  ||.:|:...|.||.:|...||::|:.::   .|..|   ::||  .|..:||:|    
 Worm   330 FVNDEWTFATLREASPPVIPSLKSDDDTTHFEEIE---TRDRD---NAGD--FQLPKTFNGNQLP 386

  Fly  1079 FFEFTF 1084
            |..||:
 Worm   387 FIGFTY 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 141/367 (38%)
S_TKc 719..1020 CDD:214567 122/305 (40%)
let-502NP_491440.1 PKc_like 41..393 CDD:304357 150/396 (38%)
S_TKc 68..330 CDD:214567 122/305 (40%)
PH-like 951..1056 CDD:302622
C1 1060..1112 CDD:197519
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.