DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and AgaP_AGAP012090

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_320436.4 Gene:AgaP_AGAP012090 / 1280583 VectorBaseID:AGAP012090 Length:1642 Species:Anopheles gambiae


Alignment Length:411 Identity:146/411 - (35%)
Similarity:211/411 - (51%) Gaps:99/411 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   693 IEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVL 757
            ||:.|.:.|.      :|:.::.:..|..||.||.||||||.:|....|| .:||||.|.|.::|
Mosquito    30 IELMKSVVQS------VKQLRLSRDDFEVLKVIGRGAFGEVCVVRMHHTS-QIYAMKILNKWEML 87

  Fly   758 KRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFE----EE 818
            ||.:.|..:.|||:|...|..|:..|:|:|||..|||.:|||..||||::||.|   ||    |:
Mosquito    88 KRAETACFREERDVLVFGDRRWITNLHYAFQDDINLYLIMDYYCGGDLLTLLSK---FEDRLPED 149

  Fly   819 LARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNH 883
            :|||||||:..|:                       ||::|.|||.|...               
Mosquito   150 MARFYIAEMVLAI-----------------------GHVRLADFGSCLRL--------------- 176

  Fly   884 SRQDSMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLE-----RSGYTQLCD 943
                           ||:.|            |.::..||||:||:||:|.     :..|...||
Mosquito   177 ---------------GPQGT------------VQSNVAVGTPDYISPEILRAMEDGQGKYGPECD 214

  Fly   944 YWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAE---LSREATDLIRRLCASADK 1005
            :||:||.:||||.|:.||.|.|.:||..|::|.:.:...|...:   :|.:|.||||||..:.:.
Mosquito   215 WWSLGVCMYEMLFGETPFYAESLVETYGKIMNHKNSFDFPNDDDEFGVSEQAKDLIRRLICAPEY 279

  Fly  1006 RLGKS-VDEVKSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDSTMSSGDDV 1069
            |||:: :|:.|:|.:|:||.:..:|..:||||||:..|||||||| ||...::.:|:...:    
Mosquito   280 RLGQNGIDDFKAHPWFEGISWDTIRNGQAPYIPEVSSPTDTSNFD-VDDTDIKLSDAVPPT---- 339

  Fly  1070 DQNDRTFHG----FFEFTFRR 1086
              .:..|.|    |..|||.:
Mosquito   340 --TNPAFSGHHLPFVGFTFTK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 136/373 (36%)
S_TKc 719..1020 CDD:214567 114/313 (36%)
AgaP_AGAP012090XP_320436.4 STKc_DMPK_like 48..357 CDD:270748 140/384 (36%)
S_TKc 50..295 CDD:214567 114/313 (36%)
Ax_dynein_light <385..475 CDD:287215
KELK 434..512 CDD:292424
COG1340 457..758 CDD:224259
DUF4200 473..>566 CDD:290574
DMPK_coil 757..816 CDD:117396
C1_1 941..991 CDD:278556
PH_MRCK 1000..1133 CDD:269949
PH 1013..1128 CDD:278594
CNH 1162..1435 CDD:279162
CRIB 1494..1532 CDD:238077
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D21674at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.