DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and Cit

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_006530193.1 Gene:Cit / 12704 MGIID:105313 Length:2123 Species:Mus musculus


Alignment Length:414 Identity:136/414 - (32%)
Similarity:208/414 - (50%) Gaps:93/414 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   659 QHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLK 723
            :|:.:.::.|........:|:        |.....|:|.:                         
Mouse    71 KHVSSFVQKYSDTIAELRELQ--------PSARDFEVRSL------------------------- 102

  Fly   724 PIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQ 788
             :|.|.|.||.:|.:..|.: :||||.::|..:|.:.||:..:.||:||:.:.:.|:.:|.|:||
Mouse   103 -VGCGHFAEVQVVREKATGD-VYAMKIMKKKALLAQEQVSFFEEERNILSRSTSPWIPQLQYAFQ 165

  Fly   789 DKDNLYFVMDYIPGGDLMSLLIKL-GIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILID 852
            ||:|||.||:|.|||||:|||.:. ...:|.:.:||:||:..||.|||:||::||||||:|||||
Mouse   166 DKNNLYLVMEYQPGGDLLSLLNRYEDQLDESMIQFYLAELILAVHSVHQMGYVHRDIKPENILID 230

  Fly   853 RDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSENGPKPTVLERRRMRDHQRVL 917
            |.|||||.|||.....             |.::.|:..|                          
Mouse   231 RTGHIKLVDFGSAAKM-------------NSNKVDAKLP-------------------------- 256

  Fly   918 AHSLVGTPNYIAPEVL------ERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINW 976
                :|||:|:|||||      .|..|...||:|||||:.|||:.|:.||...:...|...::|:
Mouse   257 ----IGTPDYMAPEVLTVMNEDRRGTYGLDCDWWSVGVVAYEMVYGKTPFTEGTSARTFNNIMNF 317

  Fly   977 EKTLHIPPQAELSREATDLIRRLCASADKRLGKSVDEVKSHDFFKGIDFADMRKQKAPYIPEIKH 1041
            ::.|..|...::|.|..||::.|.....:||  ..:.:..|.||...|:.::|....|::|.:|.
Mouse   318 QRFLKFPDDPKVSSELLDLLQSLLCVQKERL--KFEGLCCHPFFARTDWNNIRNSPPPFVPTLKS 380

  Fly  1042 PTDTSNFDPVDPEKLRSNDSTMSS 1065
            ..||||||  :|||    :|.:||
Mouse   381 DDDTSNFD--EPEK----NSWVSS 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 130/356 (37%)
S_TKc 719..1020 CDD:214567 111/307 (36%)
CitXP_006530193.1 STKc_CRIK 96..421 CDD:270752 132/381 (35%)
Smc 473..1372 CDD:224117
C1 1442..1490 CDD:237996
PH 1523..1642 CDD:214574
CNH 1687..1983 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.