DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and Cdc42bpa

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_038946162.1 Gene:Cdc42bpa / 114116 RGDID:621406 Length:1849 Species:Rattus norvegicus


Alignment Length:367 Identity:154/367 - (41%)
Similarity:222/367 - (60%) Gaps:59/367 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   708 RLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDIL 772
            ::|:.::.:..|..||.||.||||||.:| |:..::.::|||.|.|.::|||.:.|..:.|||:|
  Rat    66 KVKQMRLHREDFEILKVIGRGAFGEVAVV-KLKNADKVFAMKILNKWEMLKRAETACFREERDVL 129

  Fly   773 AEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFE----EELARFYIAEVTCAVDS 833
            ...|:.|:..|:|:|||.:|||.||||..||||::||.|   ||    ||:||||:||:..|:||
  Rat   130 VNGDSKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSK---FEDRLPEEMARFYLAEMVIAIDS 191

  Fly   834 VHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSEN 898
            ||::.::||||||||||:|.:|||:|.|||.|.                                
  Rat   192 VHQLHYVHRDIKPDNILMDMNGHIRLADFGSCL-------------------------------- 224

  Fly   899 GPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLE-----RSGYTQLCDYWSVGVILYEMLVGQ 958
                      ::.:...|.:...||||:||:||:|:     :..|...||:||:||.:||||.|:
  Rat   225 ----------KLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGE 279

  Fly   959 PPFLANSPLETQQKVINWEKTLHIPPQ-AELSREATDLIRRLCASADKRLGKS-VDEVKSHDFFK 1021
            .||.|.|.:||..|::|.::....|.| .::|..|.||||||..|.:.|||:: :::.|.|.||.
  Rat   280 TPFYAESLVETYGKIMNHKERFQFPTQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFS 344

  Fly  1022 GIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDSTM 1063
            |||:.::|..:||||||:..|||||||| ||.:.|: |..||
  Rat   345 GIDWDNIRNCEAPYIPEVSSPTDTSNFD-VDDDCLK-NSETM 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 153/358 (43%)
S_TKc 719..1020 CDD:214567 127/311 (41%)
Cdc42bpaXP_038946162.1 STKc_MRCK_alpha 4..412 CDD:270773 154/367 (42%)
SbcC <442..958 CDD:223496
KELK 530..608 CDD:406277
C1 1066..1125 CDD:412127
PH_MRCK 1127..1261 CDD:269949
CNH 1287..1551 CDD:395630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.