DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and CIT

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_011536085.1 Gene:CIT / 11113 HGNCID:1985 Length:2084 Species:Homo sapiens


Alignment Length:465 Identity:147/465 - (31%)
Similarity:224/465 - (48%) Gaps:117/465 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   646 RQYSPQA--------FKFFME---------QHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQI 693
            :|.||.:        |..|.|         :|:.|.::.|........:|:        |.....
Human    41 QQMSPLSREGILDALFVLFEECSQPALMKIKHVSNFVRKYSDTIAELQELQ--------PSAKDF 97

  Fly   694 EMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLK 758
            |:|.:                          :|.|.|.||.:|.:..|.: :||||.::|..:|.
Human    98 EVRSL--------------------------VGCGHFAEVQVVREKATGD-IYAMKVMKKKALLA 135

  Fly   759 RNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKL-GIFEEELARF 822
            :.||:..:.||:||:.:.:.|:.:|.|:||||::||.||:|.|||||:|||.:. ...:|.|.:|
Human   136 QEQVSFFEEERNILSRSTSPWIPQLQYAFQDKNHLYLVMEYQPGGDLLSLLNRYEDQLDENLIQF 200

  Fly   823 YIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQD 887
            |:||:..||.|||.||::||||||:|||:||.|||||.|||                        
Human   201 YLAELILAVHSVHLMGYVHRDIKPENILVDRTGHIKLVDFG------------------------ 241

  Fly   888 SMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLE------RSGYTQLCDYWS 946
                              ...:|..::.|.|...:|||:|:|||||.      :..|...||:||
Human   242 ------------------SAAKMNSNKMVNAKLPIGTPDYMAPEVLTVMNGDGKGTYGLDCDWWS 288

  Fly   947 VGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRLCASADKRLGKSV 1011
            ||||.|||:.|:.||...:...|...::|:::.|..|...::|.:..|||:.|.....:||  ..
Human   289 VGVIAYEMIYGRSPFAEGTSARTFNNIMNFQRFLKFPDDPKVSSDFLDLIQSLLCGQKERL--KF 351

  Fly  1012 DEVKSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEK---LRSNDSTMS----SGDDV 1069
            :.:..|.||..||:.::|....|::|.:|...||||||  :|||   :.|:...:|    ||:::
Human   352 EGLCCHPFFSKIDWNNIRNSPPPFVPTLKSDDDTSNFD--EPEKNSWVSSSPCQLSPSGFSGEEL 414

  Fly  1070 DQNDRTFHGF 1079
                 .|.||
Human   415 -----PFVGF 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 132/374 (35%)
S_TKc 719..1020 CDD:214567 110/307 (36%)
CITXP_011536085.1 STKc_CRIK 95..422 CDD:270752 136/403 (34%)
S_TKc 97..360 CDD:214567 112/333 (34%)
Smc 474..1335 CDD:224117
C1 1405..1453 CDD:237996
PH 1486..1605 CDD:278594
CNH 1650..1946 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.