DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and LOC108182331

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_017209952.1 Gene:LOC108182331 / 108182331 -ID:- Length:93 Species:Danio rerio


Alignment Length:94 Identity:44/94 - (46%)
Similarity:65/94 - (69%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   748 MKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKL 812
            ||.|.|.:::||:..|....||||:|.:.:.|:|:|..:|||:..||.||:::|||||::|....
Zfish     1 MKQLSKFEMVKRSDSAFFWEERDIMAFSQSPWIVQLCCAFQDEKYLYLVMEFMPGGDLVTLTSNY 65

  Fly   813 GIFEEELARFYIAEVTCAVDSVHKMGFIH 841
            .| .||.|:||.|||..|:|::|.:||||
Zfish    66 DI-PEEWAQFYTAEVVLALDAIHSLGFIH 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 44/94 (47%)
S_TKc 719..1020 CDD:214567 44/94 (47%)
LOC108182331XP_017209952.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.