DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and LOC101883269

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_021326563.1 Gene:LOC101883269 / 101883269 -ID:- Length:206 Species:Danio rerio


Alignment Length:244 Identity:95/244 - (38%)
Similarity:134/244 - (54%) Gaps:50/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   797 MDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTD 861
            |:::|||||::|.....| .||.|:||.|||..|:|::|.:|||||||||||:|:||:||.||.|
Zfish     1 MEFMPGGDLVTLTSNYDI-PEEWAQFYTAEVVLALDAIHSLGFIHRDIKPDNMLLDRNGHFKLAD 64

  Fly   862 FGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVGTPN 926
            ||.||                                          :|.....|...:.||||:
Zfish    65 FGTCT------------------------------------------KMDSTGLVSCDAAVGTPD 87

  Fly   927 YIAPEVLERSG----YTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAE 987
            ||:||||...|    |.:.||:|||||.:||:|||..||.:.|.:.|..|:::.:.:|..|...|
Zfish    88 YISPEVLMSQGGTGYYGRECDWWSVGVFIYELLVGDTPFYSESLVGTYGKIMDHKNSLTFPDDIE 152

  Fly   988 LSREATDLIRRLCASADKRLGKS-VDEVKSHDFFKGID--FADMRKQKA 1033
            :|::|.|||....:|.:.|||:: |:|:|.|.|||...  |..:|..|:
Zfish   153 MSKDAKDLICAFLSSREMRLGRTGVNEIKCHPFFKNDQWTFDTIRDSKS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 95/244 (39%)
S_TKc 719..1020 CDD:214567 89/227 (39%)
LOC101883269XP_021326563.1 PKc_like <1..200 CDD:328722 94/241 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.