DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and LOC101734050

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_017949838.1 Gene:LOC101734050 / 101734050 -ID:- Length:276 Species:Xenopus tropicalis


Alignment Length:276 Identity:77/276 - (27%)
Similarity:117/276 - (42%) Gaps:66/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   760 NQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYI 824
            |:.:.::..|.:...|.:.::..::.:||.::..:..|::...|.|..||.|....:.....||.
 Frog     3 NRESILREARVLRVAAGHPYLCHMHAAFQTQNYAFIAMEFASRGSLKDLLTKKHHLKTRQVIFYS 67

  Fly   825 AEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQEN--GNHSRQD 887
            ||:.|.:..:|..|.||.|:||||||:..:||||:.||||..            ||  ||.:   
 Frog    68 AEMVCGLQYLHSRGIIHSDLKPDNILVSSEGHIKIADFGLAA------------ENIFGNDT--- 117

  Fly   888 SMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILY 952
                                        :..|.  ||..|:||||||...|....|:|:.|:||.
 Frog   118 ----------------------------ICVHR--GTMKYMAPEVLEDQQYNAAVDWWAFGIILC 152

  Fly   953 EMLVGQPPF--------LANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRLCASADKRLGK 1009
            :|..|:.||        |.:|.||.:.||..|..          |:..|.|.:.|...|..|.|.
 Frog   153 QMATGRYPFNDKNGAAKLRHSILEDRPKVPVWTP----------SKVVTLLKKLLRKKASSRYGI 207

  Fly  1010 SVDEVKSHDFFKGIDF 1025
            : ..::...||..||:
 Frog   208 N-GNIRQCVFFYSIDW 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 77/276 (28%)
S_TKc 719..1020 CDD:214567 73/269 (27%)
LOC101734050XP_017949838.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.