DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and LOC100535131

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_017210028.2 Gene:LOC100535131 / 100535131 -ID:- Length:188 Species:Danio rerio


Alignment Length:230 Identity:91/230 - (39%)
Similarity:126/230 - (54%) Gaps:50/230 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   781 VKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIK 845
            ::|..:|||:..||.||:::|||||::|.....| .||.|:||.|||..|:|::|.:||||||||
Zfish     5 LQLCCAFQDEKYLYLVMEFMPGGDLVTLTSNYDI-PEEWAQFYTAEVVLALDAIHSLGFIHRDIK 68

  Fly   846 PDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSENGPKPTVLERRRM 910
            |||:|:||:||.||.|||.||                                          :|
Zfish    69 PDNMLLDRNGHFKLADFGTCT------------------------------------------KM 91

  Fly   911 RDHQRVLAHSLVGTPNYIAPEVLERSG----YTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQ 971
            .....|...:.||||:||:||||...|    |.:.||:|||||.:||:|||..||.:.|.:.|..
Zfish    92 DSTGMVSCDAAVGTPDYISPEVLMSQGGTGYYGRECDWWSVGVFIYELLVGDTPFYSESLVGTYG 156

  Fly   972 KVINWEKTLHIPPQAELSREATDLIRRLCASADKR 1006
            |:::.:.:|..|...|:|::|.|||   ||....|
Zfish   157 KIMDHKNSLTFPDDIEMSKDAKDLI---CAFLSSR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 91/230 (40%)
S_TKc 719..1020 CDD:214567 91/230 (40%)
LOC100535131XP_017210028.2 PKc_like <5..>188 CDD:328722 90/228 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.