DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and LOC100497498

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_002938754.3 Gene:LOC100497498 / 100497498 -ID:- Length:1608 Species:Xenopus tropicalis


Alignment Length:390 Identity:152/390 - (38%)
Similarity:223/390 - (57%) Gaps:64/390 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   708 RLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDIL 772
            ::|:.::.:..|..:|.||.||||||.:| |:..|..::|||.|.|.::|||.:.|..:.|||:|
 Frog    66 KVKQMRLKRDDFEIVKVIGRGAFGEVAVV-KMKGSGKIFAMKILHKWEMLKRAETACFREERDVL 129

  Fly   773 AEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFE----EELARFYIAEVTCAVDS 833
            .:.|..|:..|:|:|.|.:.||.||||..||||::||.|   ||    |::||||:||:..|:||
 Frog   130 VKGDTQWIPSLHYAFHDDNYLYLVMDYYVGGDLLTLLSK---FEDRLPEDMARFYLAEMVLAIDS 191

  Fly   834 VHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSEN 898
            :|::.::||||||||:|||..|||:|.|||.|.                                
 Frog   192 IHQLNYVHRDIKPDNVLIDLKGHIRLADFGSCL-------------------------------- 224

  Fly   899 GPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLE-----RSGYTQLCDYWSVGVILYEMLVGQ 958
                      :|:....|.:...||||:||:||:|:     :..|...||:||:||.:||:|.|:
 Frog   225 ----------KMKPDGTVESSVAVGTPDYISPEILQAMEDGKGKYGIECDWWSLGVSMYELLFGE 279

  Fly   959 PPFLANSPLETQQKVINWEKTLHIPPQ-AELSREATDLIRRLCASADKRLGK-SVDEVKSHDFFK 1021
            .||.|.|.:||..|::|.|:.|..|.. .::|.:|.|||:||....::|||| .:|:.|.|.||.
 Frog   280 TPFYAESLVETYGKIMNHEEHLQFPSDITDVSEKAKDLIQRLICRKEERLGKGGIDDFKKHPFFN 344

  Fly  1022 GIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDSTMSSGDDVDQNDRTFH--GFFEFTF 1084
            |:|:.::|....||.||:..|.|||||| ||.|.|::.|:...:    :.|..:.|  .|..|||
 Frog   345 GVDWDNIRNAIPPYTPEVDSPADTSNFD-VDDESLKNLDTLPPN----NHNGFSAHLLPFVGFTF 404

  Fly  1085  1084
             Frog   405  404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 147/373 (39%)
S_TKc 719..1020 CDD:214567 124/311 (40%)
LOC100497498XP_002938754.3 PKc_like 6..412 CDD:419665 152/390 (39%)
SbcC <438..909 CDD:223496
KELK 476..554 CDD:406277
C1_MRCKgamma 963..1014 CDD:410416
PH-like 1022..1149 CDD:418428
CNH 1178..1439 CDD:395630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.