DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wts and cdc42bpa

DIOPT Version :9

Sequence 1:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_031758436.1 Gene:cdc42bpa / 100497067 XenbaseID:XB-GENE-6037508 Length:1829 Species:Xenopus tropicalis


Alignment Length:363 Identity:151/363 - (41%)
Similarity:223/363 - (61%) Gaps:58/363 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   707 IRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDI 771
            :::|:.::.|..|..||.||.||||||.:| |:..::.::|||.|.|.::|||.:.|..:.|||:
 Frog    63 LKVKQMRLHKEDFEILKVIGRGAFGEVAVV-KLKNADKVFAMKILNKWEMLKRAETACFREERDV 126

  Fly   772 LAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFE----EELARFYIAEVTCAVD 832
            |...|:.|:..|:|:|||.:|||.||||..||||::||.|   ||    |:::|||:||:..|:|
 Frog   127 LVNGDSQWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSK---FEDRLPEDMSRFYLAEMVLAID 188

  Fly   833 SVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSE 897
            |||::.::||||||||||:|.:|||:|.|||.|.                               
 Frog   189 SVHQLHYVHRDIKPDNILLDMNGHIRLADFGSCL------------------------------- 222

  Fly   898 NGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLE-----RSGYTQLCDYWSVGVILYEMLVG 957
                       ::.:...|.:...||||:||:||:|:     :..|...||:||:||.:||||.|
 Frog   223 -----------KLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYG 276

  Fly   958 QPPFLANSPLETQQKVINWEKTLHIPPQ-AELSREATDLIRRLCASADKRLGKS-VDEVKSHDFF 1020
            :.||.|.|.:||..|::|.::....|.| |::|..|.||||||..|.:.|||:: :::.|:|.||
 Frog   277 ETPFYAESLVETYGKIMNHKERFQFPTQLADVSENAKDLIRRLICSREHRLGQNGIEDFKNHPFF 341

  Fly  1021 KGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRS 1058
            .|||:.::|..:||||||:..|||||||| ||.:.|::
 Frog   342 VGIDWDNIRNCEAPYIPEVSSPTDTSNFD-VDDDCLKN 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 149/353 (42%)
S_TKc 719..1020 CDD:214567 126/311 (41%)
cdc42bpaXP_031758436.1 PKc_like 4..445 CDD:419665 151/363 (42%)
SbcC <475..965 CDD:223496
KELK 563..641 CDD:406277
C1_MRCKalpha 1081..1140 CDD:410414
PH_MRCK 1142..1276 CDD:269949
CNH 1302..1566 CDD:395630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.