DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zfh1 and ZK686.5

DIOPT Version :9

Sequence 1:NP_733401.3 Gene:zfh1 / 43650 FlyBaseID:FBgn0004606 Length:1206 Species:Drosophila melanogaster
Sequence 2:NP_001023030.2 Gene:ZK686.5 / 3565160 WormBaseID:WBGene00022795 Length:263 Species:Caenorhabditis elegans


Alignment Length:181 Identity:36/181 - (19%)
Similarity:73/181 - (40%) Gaps:17/181 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 AQFMAAAASLAMQSARTASSPSQQQQQQLQQQQQLQQQQQHQMAMQQLLPPQLPGSNSSVGSNSA 264
            :.|.:|::.:|.:..:...:.|.::....:.:::...::...:..:..:...:..:|..: .|..
 Worm    90 SSFPSASSYIAAKKRKNVDNTSTRKPYSYKDRKRKNTEEIRNIKKKLFMDLGIVRTNCGI-DNEK 153

  Fly   265 YDLDLSAPRSTSSPGSTTGDLSGAYPCMQCTASFASREQLEQHEQLHSPCGPAAVSNVSQ-TCRI 328
            .|.:.:..|..:....||      | |..|..:|:|.:.|..|.        ..|.|... .|.:
 Worm   154 QDREKAMKRKVTETIVTT------Y-CELCEQNFSSSKMLLLHR--------GKVHNTPYIECHL 203

  Fly   329 CHKAFANVYRLQRHMISHDESALLRKFKCKECDKAFKFKHHLKEHVRIHSG 379
            |.|.|:...:..|||.:|.........:|:.||:.||.|..|:.|..:..|
 Worm   204 CMKLFSQTIQFNRHMKTHYGPNAKIYVQCELCDRQFKDKQSLRTHWDVSHG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zfh1NP_733401.3 C2H2 Zn finger 291..311 CDD:275368 6/19 (32%)
C2H2 Zn finger 326..346 CDD:275368 7/19 (37%)
zf-C2H2 355..377 CDD:278523 8/21 (38%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 369..391 CDD:290200 3/11 (27%)
Homeobox 703..755 CDD:278475
C2H2 Zn finger 969..989 CDD:275368
zf-H2C2_2 981..1006 CDD:290200
COG5048 992..>1045 CDD:227381
C2H2 Zn finger 997..1017 CDD:275368
zf-H2C2_2 1009..1034 CDD:290200
C2H2 Zn finger 1025..1042 CDD:275368
ZK686.5NP_001023030.2 C2H2 Zn finger 173..194 CDD:275368 6/28 (21%)
C2H2 Zn finger 201..221 CDD:275368 7/19 (37%)
zf-C2H2_8 <204..251 CDD:292531 15/46 (33%)
C2H2 Zn finger 232..248 CDD:275368 7/15 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.