| Sequence 1: | NP_733401.3 | Gene: | zfh1 / 43650 | FlyBaseID: | FBgn0004606 | Length: | 1206 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002729961.2 | Gene: | Hinfp / 300665 | RGDID: | 1311492 | Length: | 528 | Species: | Rattus norvegicus |
| Alignment Length: | 373 | Identity: | 76/373 - (20%) |
|---|---|---|---|
| Similarity: | 119/373 - (31%) | Gaps: | 117/373 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 294 CTASFASREQLEQHEQLHS--------PCGPAAVSNVS-------QT--------CRICHKAFAN 335
Fly 336 VYRLQRHMISHDESALLRKFKCKECDKAFKFKHHLKEHVRI-HSGEKPFGCDNCGKRFSHSGSFS 399
Fly 400 SHMTSKKCISMGLKLNNNRALLKRLEKSPGSASSASRRSPSDHGKGKLPEQPSLPGLPHPMSYFA 464
Fly 465 SDAQVQGGSAA-----------PAPFPPF-----HPNYMNAALLAF------PHNFMAAAAGLDP 507
Fly 508 --RVHPYSIQRLLQLSAAGQQQREEEREEQQK--------------------------QQQHD-- 542
Fly 543 ---EEETPDEPKLVMDIEEPETKE------------------MAPTPE 569 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| zfh1 | NP_733401.3 | C2H2 Zn finger | 291..311 | CDD:275368 | 6/16 (38%) |
| C2H2 Zn finger | 326..346 | CDD:275368 | 8/19 (42%) | ||
| zf-C2H2 | 355..377 | CDD:278523 | 7/22 (32%) | ||
| C2H2 Zn finger | 357..377 | CDD:275368 | 6/20 (30%) | ||
| zf-H2C2_2 | 369..391 | CDD:290200 | 10/22 (45%) | ||
| Homeobox | 703..755 | CDD:278475 | |||
| C2H2 Zn finger | 969..989 | CDD:275368 | |||
| zf-H2C2_2 | 981..1006 | CDD:290200 | |||
| COG5048 | 992..>1045 | CDD:227381 | |||
| C2H2 Zn finger | 997..1017 | CDD:275368 | |||
| zf-H2C2_2 | 1009..1034 | CDD:290200 | |||
| C2H2 Zn finger | 1025..1042 | CDD:275368 | |||
| Hinfp | XP_002729961.2 | C2H2 Zn finger | 171..190 | CDD:275368 | 6/16 (38%) |
| C2H2 Zn finger | 198..220 | CDD:275368 | 4/21 (19%) | ||
| COG5048 | <225..378 | CDD:227381 | 38/172 (22%) | ||
| C2H2 Zn finger | 228..248 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 254..275 | CDD:275368 | 6/20 (30%) | ||
| C2H2 Zn finger | 283..303 | CDD:275368 | 4/30 (13%) | ||
| C2H2 Zn finger | 311..334 | CDD:275368 | 6/23 (26%) | ||
| C2H2 Zn finger | 344..362 | CDD:275368 | 1/17 (6%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166354468 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||