DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2h and AT5G23830

DIOPT Version :10

Sequence 1:NP_651824.1 Gene:Npc2h / 43649 FlyBaseID:FBgn0039801 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_197772.1 Gene:AT5G23830 / 832448 AraportID:AT5G23830 Length:164 Species:Arabidopsis thaliana


Alignment Length:92 Identity:21/92 - (22%)
Similarity:35/92 - (38%) Gaps:30/92 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRLSSLLPVAFAL-----VLSSVSAEIVNFQTC-EDSVDSCSISQVRV----------------- 43
            :.:|.:.||.|.|     :|:..||.  :|:.| ::..|...:|.:.|                 
plant     1 MAMSHVQPVLFFLASLFFLLALCSAN--DFEYCTKNGHDYGVVSWIEVFRVGPQENPTLTINVFG 63

  Fly    44 TPCPEANANAACHIRRRHRFTMSFDFT 70
            |...|.:|....::..|     |.|||
plant    64 TATKEISAGTLVYVAYR-----SGDFT 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2hNP_651824.1 Npc2_like 26..153 CDD:238458 13/63 (21%)
AT5G23830NP_197772.1 PG-PI_TP 28..154 CDD:238459 13/63 (21%)

Return to query results.
Submit another query.