DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2h and AT5G06480

DIOPT Version :9

Sequence 1:NP_001247376.1 Gene:Npc2h / 43649 FlyBaseID:FBgn0039801 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_196266.1 Gene:AT5G06480 / 830536 AraportID:AT5G06480 Length:153 Species:Arabidopsis thaliana


Alignment Length:169 Identity:40/169 - (23%)
Similarity:69/169 - (40%) Gaps:41/169 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRLSSLLPVAFALVLSSVSAEI-VNFQTCEDSVD-SCSISQVRVTPCPEANANAACHIRRRHRF 63
            |.|:.::||:|...:|..||..: ::...||::.: ...:.:|.::|.|.|....|       .|
plant     1 MSRIFAILPLAAVFLLLLVSPIVAIDVHYCEENAEYEVKVKEVDISPNPIAPGEPA-------TF 58

  Fly    64 TMSFDFTPHFDADTLVASL---GW-AKSENVELPLLTMDQEACKYTTCPVRSG--------VTQT 116
            |:|.:.........||..:   || ..||..:|         |..|:||:::|        |...
plant    59 TISANTGREISFGKLVIEVSYFGWHVHSETHDL---------CTETSCPIQTGDFLVAHSQVLPG 114

  Fly   117 YTNNMPADARFPLSPYTIRWALKDPVSQKRCC--FTIDI 153
            ||         |...|.::..:.|...::..|  |:.||
plant   115 YT---------PPGSYLLKMKMLDAKKKELTCIKFSFDI 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2hNP_001247376.1 Npc2_like 26..153 CDD:238458 30/141 (21%)
AT5G06480NP_196266.1 PG-PI_TP 27..142 CDD:238459 30/139 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.