DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2h and Npc2g

DIOPT Version :9

Sequence 1:NP_001247376.1 Gene:Npc2h / 43649 FlyBaseID:FBgn0039801 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001247375.1 Gene:Npc2g / 43648 FlyBaseID:FBgn0039800 Length:159 Species:Drosophila melanogaster


Alignment Length:159 Identity:124/159 - (77%)
Similarity:137/159 - (86%) Gaps:2/159 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRLSSLLPVAFALVL--SSVSAEIVNFQTCEDSVDSCSISQVRVTPCPEANANAACHIRRRHRF 63
            |||.|||..||.|:||  ||.|||:|||:.|.||||:|:|.||||:|||||..||||:|||:|..
  Fly     1 MLRPSSLQAVAIAIVLISSSASAEVVNFEPCPDSVDTCTIQQVRVSPCPEALNNAACNIRRKHNS 65

  Fly    64 TMSFDFTPHFDADTLVASLGWAKSENVELPLLTMDQEACKYTTCPVRSGVTQTYTNNMPADARFP 128
            .|||||||:||||||||||||||||||||||||:|..|||||.|||||||.||||..:|.:|:||
  Fly    66 EMSFDFTPNFDADTLVASLGWAKSENVELPLLTLDSAACKYTPCPVRSGVKQTYTTLVPIEAKFP 130

  Fly   129 LSPYTIRWALKDPVSQKRCCFTIDIKVVR 157
            |||||||||||||||||||||||||||||
  Fly   131 LSPYTIRWALKDPVSQKRCCFTIDIKVVR 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2hNP_001247376.1 Npc2_like 26..153 CDD:238458 100/126 (79%)
Npc2gNP_001247375.1 Npc2_like 28..155 CDD:238458 100/126 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466602
Domainoid 1 1.000 119 1.000 Domainoid score I11393
eggNOG 1 0.900 - - E1_2DBFY
Homologene 1 1.000 - - H80909
Inparanoid 1 1.050 129 1.000 Inparanoid score I7037
Isobase 1 0.950 - 0 Normalized mean entropy S6567
OMA 1 1.010 - - QHG27377
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014356
OrthoInspector 1 1.000 - - mtm9669
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.