DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2h and heh-1

DIOPT Version :9

Sequence 1:NP_001247376.1 Gene:Npc2h / 43649 FlyBaseID:FBgn0039801 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001379800.1 Gene:heh-1 / 175426 WormBaseID:WBGene00006452 Length:154 Species:Caenorhabditis elegans


Alignment Length:161 Identity:45/161 - (27%)
Similarity:64/161 - (39%) Gaps:27/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VAFALVLSSVSAEI--VNFQTCEDSVDSCSISQVRVTPC--PEANANAACHIRRRHRFTMSFDFT 70
            |.|..:|...:||.  :.::.|:   ...::|||:...|  ...:....|..::..|..:...|.
 Worm     4 VIFLALLGLAAAEFIEIGYKVCK---SDGTVSQVKADGCELTVKDGKKVCLFKKGSRPIIQIAFK 65

  Fly    71 PHFDADTLVASLGWAK---SENVELPLLTMDQEACKY-TTCPVRSGVTQTY------TNNMPADA 125
            |..|.|.|..|:. ||   |..|:.|....|  ||.| ..|||.:|..|.:      |.|.||. 
 Worm    66 PSKDTDKLKTSVR-AKVGGSAMVDFPQTNSD--ACTYGVKCPVSAGENQIFEQSISITENHPAG- 126

  Fly   126 RFPLSPYTIRWALKDPVSQKRCC--FTIDIK 154
                ....:.|.|..|.|.|..|  |..:||
 Worm   127 ----EVIQVNWQLTRPDSGKEVCIIFLAEIK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2hNP_001247376.1 Npc2_like 26..153 CDD:238458 38/140 (27%)
heh-1NP_001379800.1 Npc2_like 22..150 CDD:238458 38/138 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.