DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2g and Npc2

DIOPT Version :9

Sequence 1:NP_001247375.1 Gene:Npc2g / 43648 FlyBaseID:FBgn0039800 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_075898.1 Gene:Npc2 / 67963 MGIID:1915213 Length:149 Species:Mus musculus


Alignment Length:150 Identity:33/150 - (22%)
Similarity:67/150 - (44%) Gaps:8/150 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AVAIAIVLISSSASAEVVNFEPCPDSVDTCTIQQVRVSPCPEALNNAACNIRRKHNSEMSFDFTP 73
            |..|.::.:.:::.||.::|:.|...|.  .|::|.|||||    ...|.:.:..:..::..||.
Mouse     5 AATILLLALVAASQAEPLHFKDCGSKVG--VIKEVNVSPCP----TDPCQLHKGQSYSVNITFTS 63

  Fly    74 NFDADTLVASLGWAKSENVELPLLTLDSAACKY-TPCPVRSGVKQTYTTLVPIEAKFPLSPYTIR 137
            ...:....| |.....|.:.:|....:...||. ..||::.....:|...:|::.::|.....:.
Mouse    64 GTQSQNSTA-LVHGILEGIRVPFPIPEPDGCKSGINCPIQKDKVYSYLNKLPVKNEYPSIKLVVE 127

  Fly   138 WALKDPVSQKRCCFTIDIKV 157
            |.|:|.......|:.|.:::
Mouse   128 WKLEDDKKNNLFCWEIPVQI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2gNP_001247375.1 Npc2_like 28..155 CDD:238458 29/127 (23%)
Npc2NP_075898.1 Npc2_like 24..145 CDD:238458 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6567
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.920

Return to query results.
Submit another query.