DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2g and Npc2a

DIOPT Version :9

Sequence 1:NP_001247375.1 Gene:Npc2g / 43648 FlyBaseID:FBgn0039800 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_608637.1 Gene:Npc2a / 33374 FlyBaseID:FBgn0031381 Length:148 Species:Drosophila melanogaster


Alignment Length:159 Identity:36/159 - (22%)
Similarity:59/159 - (37%) Gaps:14/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRPSSLQAVAIAIVLISSSASAEVVNFEPCPDSVDTCTIQQVRVSPCPEALNNAACNIRRKHNS 65
            |||.:.:...|:.:.       |..:.|..|.......|  :|.:..|.  ...|.|.::|....
  Fly     1 MLRYAVIACAALVVF-------AGALEFSDCGSKTGKFT--RVAIEGCD--TTKAECILKRNTTV 54

  Fly    66 EMSFDFTPNFDADTLVASLGWAKSENVELPLLTLDSAAC--KYTPCPVRSGVKQTYTTLVPIEAK 128
            ..|.||....:| |.|.::...|...:|:|....:..||  ....||:.......||..:|:...
  Fly    55 SFSIDFALAEEA-TAVKTVVHGKVLGIEMPFPLANPDACVDSGLKCPLEKDESYRYTATLPVLRS 118

  Fly   129 FPLSPYTIRWALKDPVSQKRCCFTIDIKV 157
            :|.....::|.|:|.......|..|..|:
  Fly   119 YPKVSVLVKWELQDQDGADIICVEIPAKI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2gNP_001247375.1 Npc2_like 28..155 CDD:238458 30/128 (23%)
Npc2aNP_608637.1 Npc2_like 21..145 CDD:238458 30/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451266
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.