DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2g and Npc2

DIOPT Version :9

Sequence 1:NP_001247375.1 Gene:Npc2g / 43648 FlyBaseID:FBgn0039800 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_775141.2 Gene:Npc2 / 286898 RGDID:628756 Length:152 Species:Rattus norvegicus


Alignment Length:158 Identity:36/158 - (22%)
Similarity:70/158 - (44%) Gaps:9/158 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRPSSLQAVAIAIVLISSSASAEVVNFEPCPDSVDTCTIQQVRVSPCPEALNNAACNIRRKHNS 65
            |.|.|.|....:.:.|:::: .||.::|:.|...|.  .|::|.|||||    ...|.:.:..:.
  Rat     1 MPRMSFLTPTILLLALVAAT-QAEPLHFKDCGSKVG--VIKEVNVSPCP----TQPCQLHKGQSY 58

  Fly    66 EMSFDFTPNFDADTLVASL-GWAKSENVELPLLTLDSAACKYTPCPVRSGVKQTYTTLVPIEAKF 129
            .::..||....:....|.: |......|..|:...|...|... ||::.....:|...:|:::::
  Rat    59 SVNVTFTSGTQSQNSTALVHGILAGVPVYFPIPEPDGCKCGIN-CPIQKDKVYSYLNKLPVKSEY 122

  Fly   130 PLSPYTIRWALKDPVSQKRCCFTIDIKV 157
            |.....:.|.|:|.......|:.|.:::
  Rat   123 PSLKLVVEWKLQDDKKDNLFCWEIPVEI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2gNP_001247375.1 Npc2_like 28..155 CDD:238458 29/127 (23%)
Npc2NP_775141.2 Npc2_like 27..148 CDD:238458 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.