DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2g and npc2.1

DIOPT Version :9

Sequence 1:NP_001247375.1 Gene:Npc2g / 43648 FlyBaseID:FBgn0039800 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_775331.1 Gene:npc2.1 / 282673 ZFINID:ZDB-GENE-021206-13 Length:149 Species:Danio rerio


Alignment Length:150 Identity:35/150 - (23%)
Similarity:65/150 - (43%) Gaps:10/150 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IAIVLISSSA--SAEVVNFEPCPDSVDTCTIQQVRVSPCPEALNNAACNIRRKHNSEMSFDFTPN 74
            :.:||:|..|  .|:.|.|..| .|||. .:.||.:.||    :...|.:.:..:..::..|:..
Zfish     6 LGVVLLSFLAYTCADPVKFVDC-GSVDG-KVVQVDIKPC----SQQPCKLHKGQSYTVNVTFSSG 64

  Fly    75 FDADTLVASL-GWAKSENVELPLLTLDSAACKYTPCPVRSGVKQTYTTLVPIEAKFPLSPYTIRW 138
            .::.|..|.: |......|..| :.:|........||:.......|.|.:|::.::|.....:.|
Zfish    65 VESQTSKAVVHGVLAGVPVPFP-IPIDDGCKSGIQCPIVPQKPYNYVTELPVKTEYPAIKVVVEW 128

  Fly   139 ALKDPVSQKRCCFTIDIKVV 158
            .|:|..|:...|....:::|
Zfish   129 ELRDDSSKDLFCIKFPVQIV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2gNP_001247375.1 Npc2_like 28..155 CDD:238458 28/127 (22%)
npc2.1NP_775331.1 Npc2_like 24..145 CDD:238458 28/127 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.