DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2g and NPC2

DIOPT Version :9

Sequence 1:NP_001247375.1 Gene:Npc2g / 43648 FlyBaseID:FBgn0039800 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001350617.1 Gene:NPC2 / 10577 HGNCID:14537 Length:174 Species:Homo sapiens


Alignment Length:152 Identity:41/152 - (26%)
Similarity:74/152 - (48%) Gaps:10/152 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AVAIAIVLISSSASAEVVNFEPCPDSVDTCTIQQVRVSPCPEALNNAACNIRRKHNSEMSFDFTP 73
            |....::.:|::|.||.|.|:.| .|||. .|::|.|||||    ...|.:.:..:..::..||.
Human     5 AATFLLLALSTAAQAEPVQFKDC-GSVDG-VIKEVNVSPCP----TQPCQLSKGQSYSVNVTFTS 63

  Fly    74 NFDADTLVASL-GWAKSENVELPLLTLDSAACKY-TPCPVRSGVKQTYTTLVPIEAKFPLSPYTI 136
            |..:.:..|.: |......|..|:...|  .||. ..||::.....:|...:|:::::|.....:
Human    64 NIQSKSSKAVVHGILMGVPVPFPIPEPD--GCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVV 126

  Fly   137 RWALKDPVSQKRCCFTIDIKVV 158
            .|.|:|..:|...|:.|.:::|
Human   127 EWQLQDDKNQSLFCWEIPVQIV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2gNP_001247375.1 Npc2_like 28..155 CDD:238458 34/128 (27%)
NPC2NP_001350617.1 Npc2_like 24..145 CDD:238458 34/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.