DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15543 and AMK2

DIOPT Version :9

Sequence 1:NP_001287617.1 Gene:CG15543 / 43647 FlyBaseID:FBgn0039799 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_199595.1 Gene:AMK2 / 834835 AraportID:AT5G47840 Length:283 Species:Arabidopsis thaliana


Alignment Length:141 Identity:36/141 - (25%)
Similarity:70/141 - (49%) Gaps:6/141 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 RIVLHGKPGSGRRSLAYVLAQRWNLLILDADVLAYHSINKQDQDEPSRLLQEAIEKDCVYKRSQA 153
            :|::.|.|.||:.:...::..::.|:.:.|..|....|  ....|..|..:|.:||..:.. .:.
plant    66 KIMISGAPASGKGTQCELITHKYGLVHISAGDLLRAEI--ASGSENGRRAKEHMEKGQLVP-DEI 127

  Fly   154 VGNLIENRLLQEDALHRGWILINYPNNKCEAEELFEGFTVPPNRFVFLQIDERLARMRILLNSYS 218
            |..::::||.|.|:..:||:|..||.:..:|..| :||...|:.|:.|::.|.:...|::.....
plant   128 VVMMVKDRLSQTDSEQKGWLLDGYPRSASQATAL-KGFGFQPDLFIVLEVPEEILIERVVGRRLD 191

  Fly   219 P--GPQAHVSF 227
            |  |...|:.:
plant   192 PVTGKIYHLKY 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15543NP_001287617.1 NK 89..>213 CDD:302627 33/123 (27%)
AMK2NP_199595.1 adk 66..268 CDD:273569 36/141 (26%)
ADK 66..259 CDD:238713 36/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.