DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15543 and AK8

DIOPT Version :9

Sequence 1:NP_001287617.1 Gene:CG15543 / 43647 FlyBaseID:FBgn0039799 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_005272226.1 Gene:AK8 / 158067 HGNCID:26526 Length:491 Species:Homo sapiens


Alignment Length:290 Identity:71/290 - (24%)
Similarity:119/290 - (41%) Gaps:57/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EVMSRL-----LAEISVADGVTDVRRWMGENITRIGVEIYTK----------SMDAFHRG---VR 76
            |:.:||     ::|:..|..:.:..|    ||.|: :..|.|          .:|.|::.   |:
Human   211 EIQNRLMVPEDISELETAQKLLEYHR----NIVRV-IPSYPKILKVISADQPCVDVFYQALTYVQ 270

  Fly    77 GDFYQLPRSFYHRIVLHGKPGSGRRSLAYVLAQRWNLLILDADVLAYHSINKQDQDEPSRLLQEA 141
            .: ::....|..|::|.|..|||:...|.:|||::.|:.:....|...::  .|:.....|:|..
Human   271 SN-HRTNAPFTPRVLLLGPVGSGKSLQAALLAQKYRLVNVCCGQLLKEAV--ADRTTFGELIQPF 332

  Fly   142 IEKDCVYKRSQAVGNLIENRLLQEDALHRGWILINYPNNKCEAEELFEGFTVPPNRFVFLQID-- 204
            .||:.....|..: .::..||.|:|.:.:||:|...|.:..:| .|.......|||..||.:.  
Human   333 FEKEMAVPDSLLM-KVLSQRLDQQDCIQKGWVLHGVPRDLDQA-HLLNRLGYNPNRVFFLNVPFD 395

  Fly   205 ---ERLARMRI---------LLNSYSPGPQAHVSFVDRQMAQFRKSEPALSSYLSQRR----EVV 253
               |||...||         |:  |.|.|...:.....|..:..:.:..|...|..|.    |.:
Human   396 SIMERLTLRRIDPVTGERYHLM--YKPPPTMEIQARLLQNPKDAEEQVKLKMDLFYRNSADLEQL 458

  Fly   254 Y---------VDASPCFEQVKCGIISELTK 274
            |         .|....||.::.|||:.|.|
Human   459 YGSAITLNGDQDPYTVFEYIESGIINPLPK 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15543NP_001287617.1 NK 89..>213 CDD:302627 38/137 (28%)
AK8XP_005272226.1 adk 71..270 CDD:273569 13/63 (21%)
ADK 71..261 CDD:238713 11/54 (20%)
adk 282..480 CDD:273569 51/203 (25%)
ADK 282..474 CDD:238713 49/197 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3770
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.