DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and prss60.1

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:292 Identity:91/292 - (31%)
Similarity:135/292 - (46%) Gaps:58/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 HSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAA 161
            ||.|    ::||.....|:|..|.......:.|.|.|....:.|.    :|.|||||:.:|:|||
Zfish    19 HSQL----NVCGLAPLNNRIVGGVNAFDGSWPWQVSLHSPIYGGH----FCGGSLINSEWVLTAA 75

  Fly   162 HCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDI 226
            ||:...|.:       .:.|.||: .|...|:...       :...|..|.:|.|:......|||
Zfish    76 HCLPRITTS-------SLLVFLGK-TTQQGVNTYE-------INRTVSVITVHPSYNNLTNENDI 125

  Fly   227 ALIRLAREVAYSPSIRPVCLPSTVGLQN--WQSGQAFTVAGWGRTLTSESSPVKMKLRVTYVEPG 289
            ||:.|:..|.:|..||||||.:    ||  :.:|.:..:.|||          .::|.|....||
Zfish   126 ALLHLSSAVTFSNYIRPVCLAA----QNSVFPNGTSSWITGWG----------NIQLGVNLPAPG 176

  Fly   290 LCRRKYASIV-------VLG-----DSHLCAEGRSRG--DSCDGDSGGPLMAFHEGVWVLGGIVS 340
            :.:.....:|       :||     ::.:|| |..:|  |:|.||||||:::....|||..||.|
Zfish   177 ILQETMIPVVPNDQCNALLGSGSVTNNMICA-GLLQGGRDTCQGDSGGPMVSKQCLVWVQSGITS 240

  Fly   341 FGLNCGSRFWPAVYTNVLSYETW----ITQNI 368
            :|..|...:.|.|||.|..|::|    |.||:
Zfish   241 WGYGCADPYSPGVYTRVSQYQSWINSIIVQNL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 83/270 (31%)
Tryp_SPc 116..364 CDD:214473 82/267 (31%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 81/264 (31%)
Tryp_SPc 34..267 CDD:238113 82/266 (31%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.