DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and gzma

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:277 Identity:85/277 - (30%)
Similarity:120/277 - (43%) Gaps:54/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHC 163
            |:..|.||.||           :.|....:|||.::...:.      .|.|.||:..:|:|||||
Zfish    21 TVCSDVSIVGG-----------KDVKKALSWMVSIQVNQNH------KCGGILIHKEWVLTAAHC 68

  Fly   164 VSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIAL 228
                    |.|....|:|.:|..:.|           ....:||:....|.|:|..:...:||.|
Zfish    69 --------KEDSYSSVTVLIGSLSLS-----------KGSQRIAIHNYEIPETFNKKTKKDDIML 114

  Fly   229 IRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRT--LTSESSPVKMKLRVTYVEPGLC 291
            |||:::|    ..:|..:|...  ::.|.|....|.|||.|  ...::|.....|.|..|:...|
Zfish   115 IRLSKKV----KAKPYKIPKKE--KDVQPGTKCVVRGWGTTDYKGKQASDKLQMLEVLVVDRVQC 173

  Fly   292 RRKYASIVVLGDSHLCAEG--RSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPAVY 354
            .|.|....|:....|||..  :.|| :|.|||||||......|.||.|  |.|  ||....|.||
Zfish   174 NRYYNRNPVITKDMLCAGNTQQHRG-TCLGDSGGPLECEKNLVGVLSG--SHG--CGDPKKPTVY 233

  Fly   355 TNVLS--YETWITQNIR 369
            | :||  :.|||.:.::
Zfish   234 T-LLSKRHITWINKILK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 79/256 (31%)
Tryp_SPc 116..364 CDD:214473 77/253 (30%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 82/266 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.