DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and TPSB2

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_077078.5 Gene:TPSB2 / 64499 HGNCID:14120 Length:275 Species:Homo sapiens


Alignment Length:259 Identity:83/259 - (32%)
Similarity:116/259 - (44%) Gaps:32/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVS 180
            |..|.|...:::.|.|.|..|   .:....:|.||||:.::|:||||||....:    |:: .:.
Human    31 IVGGQEAPRSKWPWQVSLRVR---DRYWMHFCGGSLIHPQWVLTAAHCVGPDVK----DLA-ALR 87

  Fly   181 VRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVC 245
            |:|.|.:.     ....:.||      |..|.:|..|.|.....||||:.|...|..|..:..|.
Human    88 VQLREQHL-----YYQDQLLP------VSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVT 141

  Fly   246 LPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKL---RVTYVEPGLCRRKY-------ASIVV 300
            ||.  ..:.:..|....|.|||.....|..|....|   :|..:|..:|..||       ..:.:
Human   142 LPP--ASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRI 204

  Fly   301 LGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWI 364
            :.|..||| |.:|.|||.|||||||:....|.|:..|:||:|..|.....|.:||.|..|..||
Human   205 VRDDMLCA-GNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 83/259 (32%)
Tryp_SPc 116..364 CDD:214473 81/257 (32%)
TPSB2NP_077078.5 Tryp_SPc 31..268 CDD:238113 83/259 (32%)
Tryp_SPc 31..267 CDD:214473 81/257 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152789
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.