DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and zgc:123295

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:275 Identity:80/275 - (29%)
Similarity:125/275 - (45%) Gaps:44/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATR 169
            ::||......:|..|.......:.|.|.|:...:.|.    :|.|||||..:|::||||..    
Zfish    25 NVCGRAPLNTKIVGGQNAGAGSWPWQVSLQSPTYGGH----FCGGSLINKDWVLSAAHCFQ---- 81

  Fly   170 ARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRI--HESFGTRLFWNDIALIRLA 232
                |....:.|:||..:.|.          ..|.||....:::  |.::......|||||::|.
Zfish    82 ----DSIGTIMVKLGLQSQSG----------SNPYQITKTVVQVINHPNYNNPSNDNDIALVKLD 132

  Fly   233 REVAYSPSIRPVCLPS-----TVGLQNWQSGQAFTVAGWGRTLTSESSPVK---MKLRVTYVEPG 289
            ..|.::..|.||||.:     ..|..:|       |.|||: |:|.::.:.   .::.:..|...
Zfish   133 SSVTFNDYIEPVCLAAAGNTYAAGTLSW-------VTGWGK-LSSAANQIPDILQEVEIPIVSHS 189

  Fly   290 LCRRKYASIVVLGDSHLCAEGRSRG--DSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPA 352
            .|:|.|...:.  .:.:||....:|  |||.||||||:::.:...|:..||||||..|....:|.
Zfish   190 DCKRAYPGEIT--SNMICAGLLDQGGKDSCQGDSGGPMVSRNGSQWIQSGIVSFGRGCAEPGYPG 252

  Fly   353 VYTNVLSYETWITQN 367
            ||..|..|:.|||.:
Zfish   253 VYARVSQYQDWITSS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 78/262 (30%)
Tryp_SPc 116..364 CDD:214473 75/259 (29%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 75/260 (29%)
Tryp_SPc 36..264 CDD:238113 75/259 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.