DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and zgc:123217

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:273 Identity:77/273 - (28%)
Similarity:129/273 - (47%) Gaps:35/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 CGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRAR 171
            ||......:|..|.:.....:.|.|.:.|..      |..|.|:||::::|:|||||:       
Zfish    28 CGVAPLNTRIVGGTDAPAGSWPWQVSIHYNN------RHICGGTLIHSQWVMTAAHCI------- 79

  Fly   172 KGDVSFRVSV---RLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAR 233
               ::..::|   .||....|..|      ..|..|::.::.|..|.||...|..|||:|::|::
Zfish    80 ---INTNINVWTLYLGRQTQSTSV------ANPNEVKVGIQSIIDHPSFNNSLLNNDISLMKLSQ 135

  Fly   234 EVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKL---RVTYVEPGLCRRKY 295
            .|.:|..|||:||.:...:  :.:|.:....|||.....::.|....|   ::..|...||..:|
Zfish   136 PVNFSLYIRPICLAANNSI--FYNGTSCWATGWGNIGKDQALPAPQTLQQVQIPVVANSLCSTEY 198

  Fly   296 ASI--VVLGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLN--CGSRFWPAVYTN 356
            .|:  ..:....:|| |::...:|.||||||.......||:..||.|:|.:  |....:|.||:.
Zfish   199 ESVNNATITPQMICA-GKANKGTCQGDSGGPFQCKQGSVWIQAGITSYGTSAGCAVGAYPDVYSR 262

  Fly   357 VLSYETWITQNIR 369
            |..:::||..|::
Zfish   263 VSEFQSWIKMNVQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 74/260 (28%)
Tryp_SPc 116..364 CDD:214473 72/257 (28%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 72/258 (28%)
Tryp_SPc 37..273 CDD:238113 74/260 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.