DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG18754

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:395 Identity:119/395 - (30%)
Similarity:170/395 - (43%) Gaps:85/395 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVIAAVLLCLLIIRTAHGQYVSC--RNPNQRTGYCVNIPLCVPLNSVLAKSNPTDSEMRFIRESR 64
            ||...|||..:..    .|...|  .:..|:...|..:..|.||.::|.....|.:|.......:
  Fly     6 KVYILVLLQAIFF----NQLAECVRLSSCQKDEKCTRLVSCSPLMNILRPRGMTQAEKDVFAHRQ 66

  Fly    65 CLVSDQS----DLPFVCCTPDTDYNTTRARPNDEVIHSTLLPDRSICGGDIAYNQIT-----KGN 120
            |.:....    .:.:|||....|                :||::..||      |.|     :|.
  Fly    67 CGLDPNGHELLHMVYVCCPELGD----------------VLPNKQTCG------QTTPVFRDRGA 109

  Fly   121 ETV-LTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLG 184
            |.. |.|:.|||||.|.    .:|      |||  |||:||||||... ...:.|:..: |||||
  Fly   110 ENAELNEYPWMVLLLYE----NRL------SLI--RYVLTAAHCVIGG-YLTQNDLVLK-SVRLG 160

  Fly   185 EHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESF----GTRLFWNDIALIRLAREVAYSPSIRPVC 245
            |..|    ||:........:.:.|.:..:|:.|    ||  :.|||||:||...|.|:..|:|:|
  Fly   161 ESTT----DCITSESRCPHLDVEVGQTTVHQGFTSSGGT--YRNDIALLRLQFPVRYTKKIQPIC 219

  Fly   246 -LPSTVGLQNWQSGQAFTVAGWGRTLTSE---SSPVKMKLRVTYVEPGLCRRKYASIVVLGDSHL 306
             |.:...||:..    ..::||..|.:|:   :|.||.:      .|..|..:|.|.  ...|.:
  Fly   220 LLDAEFPLQDLN----LQISGWDPTKSSQTLITSTVKER------NPADCLNRYPSF--RSASQV 272

  Fly   307 CAEGRSRGDSCDGDSGGPLMAF-----HEGVWVLGGIVSFGLN-CGSRFWPAVYTNVLSYETWIT 365
            ||.|:.:||:|.|.||.|:|..     .|.|: |.||.|:|.. |.|...|.|||.:..:..||.
  Fly   273 CAGGQRKGDTCAGISGSPVMGIMGSGVDEFVF-LAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336

  Fly   366 QNIRP 370
            .|:.|
  Fly   337 ANLAP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 11/59 (19%)
Tryp_SPc 116..367 CDD:238113 92/270 (34%)
Tryp_SPc 116..364 CDD:214473 90/267 (34%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 9/48 (19%)
Tryp_SPc 108..338 CDD:238113 91/262 (35%)
Tryp_SPc 108..335 CDD:214473 89/259 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.